DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tace and adam11

DIOPT Version :8

Sequence 1:NP_733334.1 Gene:Tace / 43558 FlyBaseID:FBgn0039734 Length:732 Species:Drosophila melanogaster
Sequence 2:XP_021335948.1 Gene:adam11 / 567145 ZFINID:ZDB-GENE-070808-3 Length:788 Species:Danio rerio

Alignment Length:603 Identity:139/604 (23%)
Similarity:226/604 (37%) Gaps:143/604 (24%)


  Fly    57 TNPFNTIKEVEF--TTLGKNFRLILHPHRDVLHSKFRAYAVDADGNETVVHMDHDSFYSGRVFGE 119
            |:|.: :.::.|  ...|..|.|.|..:.|:|.|.:.....:.||...........:|.|.|.|.
Zfish    75 THPIH-LAQITFLVKAFGIPFVLDLELNHDLLSSNYVERHFEKDGQSFQTLGGEHCYYHGHVRGV 138

  Fly   120 LES--------SVRAHIEDGTMTMSIHLPEETYHIEPSWRHLPEAK--------KDT--MVAYKA 166
            ..|        .::....||..:..|    |..|......|  ::|        ||.  .|.|:.
Zfish   139 PRSWAALSTCHGLQGMFSDGNFSYGI----EPLHNSSDQTH--DSKIIEEDASIKDANIHVVYRM 197

  Fly   167 SDVKVHKNEAGATPKTC-----GYIKEGLELEDKEHGDTLDNELHTREKRQSDQYEYT-PTKTR- 224
            :|:::..:.:|:|..:.     ......:|....|..|.|     .|.|||..:...| .::|: 
Zfish   198 ADIRLMPHFSGSTRNSSDSDINNDYPVSMETSQLELTDGL-----RRAKRQVRRGPRTVQSETKY 257

  Fly   225 CPLLLVADYRFFQEMGGGNTKTTINYLISLIDRVHKIYNDTVWQDRSDQEGFKGMGFVIKKIVVH 289
            ..||:|.||..|.:|...:.:|. |:..::::....||.:.                :..:||: 
Zfish   258 VELLVVNDYDLFVQMRRSSPQTR-NFAKAVVNMADAIYKEQ----------------LNTRIVL- 304

  Fly   290 SEPTRLRGGEAHYNMIREKWDVRNLLEV-------------FSREYSHKDFCLAHLFTDLKFEGG 341
                          :..|.|..:|::.|             :.:|...:....|||.:...|:..
Zfish   305 --------------VAMETWSTQNMVSVGDDPLVTLRDFMKYRKENIKEKSDTAHLLSGRTFQSS 355

  Fly   342 ILGLAYVGSPRRNSVGGICTPEYFKNGYTLYLNSGLSSSRNHYGQRVITREADLVTAHEFGHNWG 406
            ..|.||        :.|||:|          ...|..:...:.|...||      .....|.|.|
Zfish   356 RSGTAY--------IEGICSP----------TRGGGVNEYGNVGPMAIT------LCQSLGQNLG 396

  Fly   407 SEHDPDIPECSPSASQG-----GSFLMYTYSVSGYDVNNKKFSPCSLRSIRKVLQAKSGRC-FSE 465
            ...:.|      .|:.|     ..:|......:||.: .:|||.||:....:.||...|.| |::
Zfish   397 MMWNKD------RATAGDCRCPDPWLGCIMEDTGYYL-PRKFSRCSIEEYIQFLQQGGGSCLFNK 454

  Fly   466 PEESF----CGNLRVEGDEQCDAG--LLGTEDNDSCCDKNCKLRRNQGAMCSDKNSPCCQNCQFM 524
            |.:..    |||..||..|:||.|  :..:....:|| |.|.|..:  ||||  |..||..|::.
Zfish   455 PNKLLDPPECGNGFVEQGEECDCGSQVDCSRAGGACC-KKCTLTHD--AMCS--NGLCCNRCKYE 514

  Fly   525 ASGMKCREAQYATCEQEARCTGAHAECPKSPAMADGTTCQE-RGQCRNGKCVPYCETQGLQSCMC 588
            ..|:.||:| ...|:....|:|..::||.:....||..|.. .|:|..|:    |:|:..|   |
Zfish   515 QRGVICRDA-VNDCDVPETCSGDSSKCPHNVHKLDGYMCDAGLGRCYGGR----CKTRDAQ---C 571

  Fly   589 DII--ADACKRCCRMSIN 604
            ..:  .:|..|.|...:|
Zfish   572 QALWGHNAADRMCYEKLN 589

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TaceNP_733334.1 Pep_M12B_propep 50..162 CDD:279848 26/125 (21%)
ZnMc_TACE_like 223..470 CDD:239798 54/267 (20%)
Reprolysin_2 244..456 CDD:290307 41/230 (18%)
Disintegrin 477..552 CDD:278623 26/77 (34%)
ADAM17_MPD 576..633 CDD:271205 8/32 (25%)
adam11XP_021335948.1 Pep_M12B_propep 68..195 CDD:307618 27/127 (21%)
Reprolysin 256..455 CDD:307535 52/262 (20%)
Disintegrin 470..543 CDD:306668 27/79 (34%)
ACR 547..688 CDD:214743 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4147
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.