DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tace and ADAM8

DIOPT Version :8

Sequence 1:NP_733334.1 Gene:Tace / 43558 FlyBaseID:FBgn0039734 Length:732 Species:Drosophila melanogaster
Sequence 2:XP_016870954.1 Gene:ADAM8 / 101 HGNCID:215 Length:889 Species:Homo sapiens

Alignment Length:786 Identity:177/787 (22%)
Similarity:268/787 (34%) Gaps:281/787 (36%)


  Fly    30 QKTLRHYEIFHKDDVVHRVVKRGAKHSTNPFNTIKEVEFTTLGKNFRLILHPHRDVLHSKFRAYA 94
            ::..||::..|.:.|.:.:   ||                 .|.||.|.|..:||:|.|.:....
Human   108 RRLCRHHQGLHPERVSYVL---GA-----------------TGHNFTLHLRKNRDLLGSGYTETY 152

  Fly    95 VDADGNETVVH---MDHDSFYSGRVFGELESS--------VRAHIEDGTMTMSIHLPEETYHIEP 148
            ..|:|:|....   .|| .||.|.|.|..:|:        :|...:.|:   .:||      |||
Human   153 TAANGSEVTEQPRGQDH-CFYQGHVEGYPDSAASLSTCAGLRGFFQVGS---DLHL------IEP 207

  Fly   149 ------SWRHLPEAKKDTMVAYKASDVKVHKNEAGATPKTCGYIKEGLELEDKEHGDTL------ 201
                  ..||         ..|:|..:.       .|..|||       :.|...|..|      
Human   208 LDEGGEGGRH---------AVYQAEHLL-------QTAGTCG-------VSDDSLGSLLGPRTAA 249

  Fly   202 ------DNELHTREKRQSDQYEYTPTKTRCPLLLVADYRFFQEMGGGNTKTTINY-LISLIDRVH 259
                  .:.|.:||.|..:.|            :|.|...||.:|   ::..:.: ::.:::.|.
Human   250 VFRPRPGDSLPSRETRYVELY------------VVVDNAEFQMLG---SEAAVRHRVLEVVNHVD 299

  Fly   260 KIYND----------TVW--QDRSDQEGFKGMGFVIKKIVVHSEPTRLRGGEAHYNMIREKWDVR 312
            |:|..          .:|  |||                 .|..|......|   |::  .|..|
Human   300 KLYQKLNFRVVLVGLEIWNSQDR-----------------FHVSPDPSVTLE---NLL--TWQAR 342

  Fly   313 NLLEVFSREYSHKDFCLAHLFTDLKFEGGILGLAYVGSPRRNSVGGICTPEYFKNGYTLYLNSGL 377
            ..    :|.:.|.:   ..|.|.:.|.|..:|.|.|.:...:|.|.:                ..
Human   343 QR----TRRHLHDN---VQLITGVDFTGTTVGFARVSAMCSHSSGAV----------------NQ 384

  Fly   378 SSSRNHYGQRVITREADLVTAHEFGHNWGSEHDPDIP-----------ECSPSASQGGSFLMYTY 431
            ..|:|..|       .....|||.|||.|.:||.::.           .|..:.|.|.||     
Human   385 DHSKNPVG-------VACTMAHEMGHNLGMDHDENVQGCRCQERFEAGRCIMAGSIGSSF----- 437

  Fly   432 SVSGYDVNNKKFSPCSLRSIRKVLQAKSGRCFSE-PEES------FCGNLRVEGDEQCDAGLLGT 489
                    .:.||.||...:...|:.....|.:. |:.|      .||||.||..||||.|  ..
Human   438 --------PRMFSDCSQAYLESFLERPQSVCLANAPDLSHLVGGPVCGNLFVERGEQCDCG--PP 492

  Fly   490 ED-NDSCCDK-NCKLRRNQGAMCSDKNSPCCQNCQFMASGMKCREAQYATCEQEARCTGAHAECP 552
            || .:.||:. .|:|.  :||.|:  :..|||.|:...:|..||..: ..|:.|..|.|.|.|||
Human   493 EDCRNRCCNSTTCQLA--EGAQCA--HGTCCQECKVKPAGELCRPKK-DMCDLEEFCDGRHPECP 552

  Fly   553 KSPAMADGTTCQERGQCRNGKC---------------------------VPYCETQGLQSCMCDI 590
            :.....:||.| ..|.|.||.|                           :|.|:....::.||.:
Human   553 EDAFQENGTPC-SGGYCYNGACPTLAQQCQAFWGPGGQAAEESCFSYDILPGCKASRYRADMCGV 616

  Fly   591 IADACKR---------C----CRMSINETCFPVEPPDVLPDGT------PCITGFC--------- 627
            :  .||.         |    |.....|.....||   :|:||      .|..|.|         
Human   617 L--QCKGGQQPLGRAICIVDVCHALTTEDGTAYEP---VPEGTRCGPEKVCWKGRCQDLHVYRSS 676

  Fly   628 -------NKGVCEKTIQDVVERFW------DIIEEINVAK-TLRFLKDNIVMAVVLVTAVFWIPI 678
                   |.|||....:......|      .::.|::.|. :|..    .|:.|:::.||..:.:
Human   677 NCSAQCHNHGVCNHKQECHCHAGWAPPHCAKLLTEVHAASGSLPV----FVVVVLVLLAVVLVTL 737

  Fly   679 SCVISY 684
            :.:|.|
Human   738 AGIIVY 743

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TaceNP_733334.1 Pep_M12B_propep 50..162 CDD:279848 31/129 (24%)
ZnMc_TACE_like 223..470 CDD:239798 54/278 (19%)
Reprolysin_2 244..456 CDD:290307 46/236 (19%)
Disintegrin 477..552 CDD:278623 29/77 (38%)
ADAM17_MPD 576..633 CDD:271205 21/92 (23%)
ADAM8XP_016870954.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4147
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.