DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7903 and Rbm4b

Sequence 1:NP_651755.2 Gene:CG7903 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_079993.2 Gene:Rbm4b MGIID:1913954 Length:357 Species:Mus musculus

Alignment Length:270 Identity:69/271 (25%)
Similarity:109/271 (40%) Gaps:47/271 (17%)


  Fly     4 TAKVFVGSL-PRCKPEELRRLFTNYGSVVECDVMNRCAFVHLENTDMAEAAIAALNGTIFKGQPI 67
            :.|:.||:: |.|..:|||..|..||.|:|||::...||||:|..:.|..||..|:.|.|:|:.:
Mouse    77 STKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRM 141

  Fly    68 VVEAGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHESN---TNFKRNFREEVG----- 124
            .|:....:.      |..||.||..|......:|..:.:.|.:..   .:|...:.|:.|     
Mouse   142 HVQLSTSRL------RTAPGMGDQSGCYRCGKEGHWSKECPVDRTGRVADFTEQYNEQYGAVRTP 200

  Fly   125 -------GRFSNEG-----------PRSSNSSAAKFGPVRNESNYRQQRSA----PYSKGPPNNE 167
                   ..:.|:.           .||..:.||  ....:..||.:|..:    ..|...|::.
Mouse   201 YTMGYGESMYYNDAYGALDYYKRYRVRSYEAVAA--AAAASAYNYAEQTMSHLPQVQSSAVPSHL 263

  Fly   168 SSNQGQGF-RNKFAGGGKFGGSAGNEGRFGSNRFQQRDNSGPQPGRRNFKNSPT--SGYRGGGNN 229
            :|.....: |:.....|....||..... .|:.:..||.|   |.|||....|.  .|| |.|..
Mouse   264 NSTSVDPYDRHLLQNSGSAATSAAMAAA-ASSSYYGRDRS---PLRRNAAVLPAVGEGY-GYGPE 323

  Fly   230 SDFQGGSSSS 239
            |:....|:::
Mouse   324 SEMSQASAAT 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 49/195 (25%)
RRM_SF 6..70 CDD:302621 28/65 (43%)
Rbm4bNP_079993.2 RRM1_RBM4 2..68 CDD:241050
RRM2_RBM4 78..144 CDD:241051 28/66 (42%)
ZnF_C2HC 161..176 CDD:197667 2/15 (13%)
Interaction with TNPO3. {ECO:0000250} 196..357 30/146 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1563362at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.970

Return to query results.
Submit another query.