DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7903 and rbm4.1

Sequence 1:NP_651755.2 Gene:CG7903 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_955999.1 Gene:rbm4.1 ZFINID:ZDB-GENE-030131-3902 Length:419 Species:Danio rerio

Alignment Length:330 Identity:84/331 (25%)
Similarity:117/331 (35%) Gaps:96/331 (29%)


  Fly     3 TTAKVFVGSL-PRCKPEELRRLFTNYGSVVECDVMNRCAFVHLENTDMAEAAIAALNGTIFKGQP 66
            |:.|..||:: ..|..:|||..|..||.|||||::...||||:|..:.|..||:.|:.|.|:|:.
Zfish    76 TSTKPHVGNISSSCTNQELRAKFEEYGPVVECDIVKDYAFVHMERVEDAMEAISGLDNTAFQGKL 140

  Fly    67 IVVEAGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHESNTNFKRNFREEVGGRFSNEG 131
            :.|:....:.      |..||.|:..|......:|..:.:.|.:.|.:::             ||
Zfish   141 MSVKLSTSRL------RTAPGMGERTGCYRCGQEGHWSKECPLDQNGSYR-------------EG 186

  Fly   132 PRSSNSSAAKFGPVRNESNYRQQRSAPYSKGPPNNESSNQGQGFRNKFAGGGKFGGSAGNEGRFG 196
            |.|..     |||||.:|                  ..::|:||...|:|...:.||        
Zfish   187 PSSEG-----FGPVRFDS------------------GGDRGRGFHRGFSGEPAYAGS-------- 220

  Fly   197 SNRFQQRDNSGPQPGRRNFKNSPTSGY-RGGGNNSDFQGGSSSSGGGGSVNQRAGGGGPGPSHVR 260
                     ..|..|..........|| ||.|..|....|..:..|.|:.|..|...|   |...
Zfish   221 ---------FAPSHGFTRGAGYAVPGYGRGAGFESAMGYGMPAGYGVGADNSMAPVYG---SEAA 273

  Fly   261 QDRRGFALPVEHQQQQMGFGRFGNGPMNSGNRGTNGGNPP-------GGRGFFNG------GGGG 312
            ....|.|.|          |.....|:.         .||       |...|:..      ||..
Zfish   274 YGTSGMAYP----------GALPAYPIR---------RPPYEERDPYGVVDFYEKYRARPYGGSY 319

  Fly   313 FNDRR 317
            |.|||
Zfish   320 FEDRR 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 46/165 (28%)
RRM_SF 6..70 CDD:302621 28/65 (43%)
rbm4.1NP_955999.1 RRM1_RBM4 2..68 CDD:241050
RRM2_RBM4 78..144 CDD:241051 28/66 (42%)
ZnF_C2HC 161..176 CDD:197667 2/15 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1563362at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
21.970

Return to query results.
Submit another query.