powered by:
                  
 
    
 
    
             
          
            Protein Alignment CG7903 and rbm4b
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_651755.2 | 
            Gene: | CG7903 / 43554 | 
            FlyBaseID: | FBgn0039730 | 
            Length: | 384 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_989204.1 | 
            Gene: | rbm4b / 394812 | 
            XenbaseID: | XB-GENE-494431 | 
            Length: | 338 | 
            Species: | Xenopus tropicalis | 
          
        
        
        
          
            | Alignment Length: | 83 | 
            Identity: | 34/83 - (40%) | 
          
          
            | Similarity: | 48/83 -  (57%) | 
            Gaps: | 3/83 - (3%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly     4 TAKVFVGSL-PRCKPEELRRLFTNYGSVVECDVMNRCAFVHLENTDMAEAAIAALNGTIFKGQPI 67 
            :.|:.|.:| ..|..||||..|..||:|:|||::...||||:|.:..|..||..|:.|.|||:.: 
 Frog    77 STKLHVSNLSTSCTSEELRAKFEEYGAVLECDIVKDYAFVHMERSAEALDAIKNLDNTEFKGKRM 141 
 
  Fly    68 VVE--AGRPKYGPGGGSR 83 
            .|:  ..|.:..||.|.| 
 Frog   142 HVQLSTSRLRVTPGMGER 159 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Compara | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Domainoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | eggNOG | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Hieranoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoDB | 
            1 | 
            1.010 | 
            - | 
            - | 
             | 
            D1563362at2759 | 
          
          
            | OrthoFinder | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Panther | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Phylome | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | RoundUp | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SonicParanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SwiftOrtho | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | TreeFam | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            1 | 1.010 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.