DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7903 and rbm4b

Sequence 1:NP_651755.2 Gene:CG7903 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_989204.1 Gene:rbm4b XenbaseID:XB-GENE-494431 Length:338 Species:Xenopus tropicalis

Alignment Length:83 Identity:34/84 (40%)
Similarity:48/84 (57%) Gaps:3/84 (4%)


  Fly     4 TAKVFVGSL-PRCKPEELRRLFTNYGSVVECDVMNRCAFVHLENTDMAEAAIAALNGTIFKGQPI 67
            :.|:.|.:| ..|..||||..|..||:|:|||::...||||:|.:..|..||..|:.|.|||:.:
 Frog    77 STKLHVSNLSTSCTSEELRAKFEEYGAVLECDIVKDYAFVHMERSAEALDAIKNLDNTEFKGKRM 141

  Fly    68 VVE--AGRPKYGPGGGSR 83
            .|:  ..|.:..||.|.|
 Frog   142 HVQLSTSRLRVTPGMGER 159

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 34/84 (40%)
RRM_SF 6..70 CDD:302621 29/65 (45%)
rbm4bNP_989204.1 RRM_SF 2..68 CDD:327398
RRM_SF 78..144 CDD:327398 29/66 (44%)
ZnF_C2HC 161..176 CDD:197667
DWNN <162..>201 CDD:331509
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1563362at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.970

Return to query results.
Submit another query.