DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7903 and fne

Sequence 1:NP_651755.2 Gene:CG7903 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001096965.1 Gene:fne FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster

Alignment Length:143 Identity:31/144 (22%)
Similarity:47/144 (33%) Gaps:58/144 (40%)


  Fly     5 AKVFVGSLPR-CKPEELRRLFTNYGSVVE----CD----VMNRCAFVHLENTDMAEAAIAALNGT 60
            |.::|..||: ....:|..:|.::|.::.    ||    :.....|:..:..:.||.||..|||.
  Fly   130 ANLYVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNGK 194

  Fly    61 IFKG--QPIVVE--------------------------------------AGRPKYGPGGG---- 81
            ..||  :||.|:                                      |||.:|.|..|    
  Fly   195 TPKGYAEPITVKFANNPSNSAKAQIAPPLTAYLTPQAAAATRRLAGALPSAGRIRYSPLAGDLLA 259

  Fly    82 -----SRGQPGSG 89
                 .....|||
  Fly   260 NSILPGNAMTGSG 272

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 31/144 (22%)
RRM_SF 6..70 CDD:302621 21/75 (28%)
fneNP_001096965.1 RRM 23..354 CDD:330708 31/144 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C68504294
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.