DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7896 and LOC1270808

DIOPT Version :10

Sequence 1:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster
Sequence 2:XP_309529.4 Gene:LOC1270808 / 1270808 VectorBaseID:AGAMI1_014460 Length:297 Species:Anopheles gambiae


Alignment Length:180 Identity:54/180 - (30%)
Similarity:88/180 - (48%) Gaps:11/180 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   645 EELDISDNQLSYLFPSSFRIHPRLREIRAANNKFSFFPAELISTLQYLEHIDLSHNQLKTIEELD 709
            |:|:|.:..|..:.     :.|.||.:.|::|.|.....|.....| |..::||:|:.::||.:.
Mosquito    87 EKLEIQNVSLQTMV-----LWPNLRSLDASHNYFFELIVEPGQNYQ-LRELNLSYNRFQSIEFVQ 145

  Fly   710 FARLPRLRVLLVANNQLDMVSEMAFHNSTQLQILDLAHNNLDRIGERTFEGLVRLEQLNLEGNRL 774
              .||.||.|.:.:|.|:.:|...|..:|:|..|:||:|.|..|.......|.||..|.|..|.|
Mosquito   146 --ALPALRTLDLRHNYLESLSFSLFDMATELWKLNLANNRLQTISTDGSLHLPRLSTLLLHDNLL 208

  Fly   775 SELSDGVFERTKLQMLENINLAHNRFEYAPLNALQRQFFFVSSVDLSHNK 824
            |.|....:   :..||:.:|:|.||..|..:..:...|..:.::.|..|:
Mosquito   209 SVLDASEW---RFSMLQELNVARNRLRYLSMCEVNHSFPHLQTLYLDENR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7896NP_651754.1 PRK15370 20..>410 CDD:185268
leucine-rich repeat 109..132 CDD:275380
leucine-rich repeat 133..161 CDD:275380
leucine-rich repeat 162..185 CDD:275380
leucine-rich repeat 186..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380
leucine-rich repeat 234..257 CDD:275380
PLN00113 237..>750 CDD:215061 33/104 (32%)
leucine-rich repeat 258..281 CDD:275380
leucine-rich repeat 282..329 CDD:275380
leucine-rich repeat 330..353 CDD:275380
leucine-rich repeat 354..377 CDD:275380
leucine-rich repeat 378..401 CDD:275380
leucine-rich repeat 402..425 CDD:275380
leucine-rich repeat 428..451 CDD:275380
leucine-rich repeat 452..473 CDD:275380
leucine-rich repeat 477..497 CDD:275378
leucine-rich repeat 500..523 CDD:275380
leucine-rich repeat 524..547 CDD:275380
leucine-rich repeat 548..571 CDD:275380
leucine-rich repeat 572..595 CDD:275380
leucine-rich repeat 596..619 CDD:275380
leucine-rich repeat 620..643 CDD:275380
leucine-rich repeat 644..667 CDD:275380 4/21 (19%)
leucine-rich repeat 668..691 CDD:275380 6/22 (27%)
LRR <684..1020 CDD:443914 44/141 (31%)
leucine-rich repeat 692..715 CDD:275380 7/22 (32%)
leucine-rich repeat 716..739 CDD:275380 7/22 (32%)
leucine-rich repeat 740..761 CDD:275380 7/20 (35%)
leucine-rich repeat 764..789 CDD:275380 7/24 (29%)
leucine-rich repeat 790..810 CDD:275380 6/19 (32%)
leucine-rich repeat 818..850 CDD:275380 2/7 (29%)
leucine-rich repeat 863..883 CDD:275378
leucine-rich repeat 884..907 CDD:275380
leucine-rich repeat 908..933 CDD:275380
leucine-rich repeat 934..955 CDD:275380
leucine-rich repeat 958..982 CDD:275380
leucine-rich repeat 983..1055 CDD:275380
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
LRRCT 1121..1168 CDD:214507
LOC1270808XP_309529.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.