DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG31269

DIOPT Version :10

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:57 Identity:17/57 - (29%)
Similarity:26/57 - (45%) Gaps:14/57 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   516 GTNHEGDQP--AHLTLKDDT---VPVKNNLTIYDGP---EARF--C----PAGVYEY 558
            |.::|...|  ::.|.|:.|   :.|.|...:|||.   :.||  |    ||...|:
  Fly    34 GESYENCSPWLSYATAKNKTCYNLCVHNCAAVYDGSCINDRRFKCCLATFPAKKQEF 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 41..266 CDD:238113
CG31269NP_001097818.1 Tryp_SPc 38..258 CDD:238113 16/53 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.