DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MPO and cd

Sequence 1:NP_000241.1 Gene:MPO HGNCID:7218 Length:745 Species:Homo sapiens
Sequence 2:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster

Alignment Length:799 Identity:253/800 (32%)
Similarity:372/800 (47%) Gaps:115/800 (14%)


Human     1 MGVPF----FSSLRCMVDLGPCWAGGLTAEMKLLLALAGLLAILA--TPQPSEGAA-----PAVL 54
            ||:.|    |::| |:..:.....||..........:.|..:.||  .|.|.|.||     .|.|
  Fly    51 MGITFIAIVFTAL-CLALVFSDSLGGADGGPSFFFVVNGSDSELAPNRPLPDEPAAEWALQQAAL 114

Human    55 GEVDTSLVLSSMEEAKQLVDKAYKERRESIKQRLRSGSASPMELLSY--FKQPVAATRTAVRAAD 117
            |..|.:..:|:  ..|.|.|      ||.:::.|:....:......|  ......|.:.|.|...
  Fly   115 GHHDGAQAVSA--GIKALGD------REILEEGLQPNEVNTPSFRHYRSLSTNPEARKLARRGYV 171

Human   118 YLHVALDLLERKLRSLWRRPFNVTDVLTPAQLNVLSKSSGCAYQDV-------GVTCPEQDKYRT 175
            .....:|:.:|         ||.|.  .|.:.|:     |...:.|       .:.|....:||.
  Fly   172 ENQATIDIAKR---------FNYTK--QPGRSNI-----GWGPKIVLPDPTVLRLECDFNARYRR 220

Human   176 ITGMCNNRRSP-TLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPT 239
            .||:|||::.| |.|||...:.|.:..:|.||.:     .|.|..:| .:..||.||.:|.|   
  Fly   221 STGVCNNKQHPRTYGASMVPYRRMVSPDYADGIA-----APRVSHHG-RLPPARQVSLKIHR--- 276

Human   240 DQLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCV-----QQPPCFPLKIPPN 299
            .....|...::|...:||.:|||:..|....::..  ..::|   ||     |.|.|:|:.|.|:
  Fly   277 SSYETDSNFTVMLAVFGQFMDHDITATSLTTSQEG--ESIDC---CVAATREQHPECYPVDILPD 336

Human   300 DPRIKN-QADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQLGLL 363
            ||..|. ...|:.|.||.|| |......|.|:|..|:|:|||:|||:.|.....||:..|.    
  Fly   337 DPYYKQYNISCMNFVRSAPA-PTGRFGPRMQLNQATAFIDASVVYGNLEQRQNQLRSFING---- 396

Human   364 AVNQRFQDNGRALLPFDNLHDDPCLLTNR--SARIP--CFLAGDTRSSEMPELTSMHTLLLREHN 424
            ::.....|:||.|||..:...|.|   ||  ..|:.  ||.:||.|::|...|||||.|..|.||
  Fly   397 SLRMFVTDDGRQLLPISSNPADGC---NRVQMTRLGKYCFESGDDRANENLLLTSMHLLWARHHN 458

Human   425 RLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGP--TAMRKYLPTYR------S 481
            .||.:|:..||.|:.||||||||||:||.:..|||.::||::||.  :..:..||...      :
  Fly   459 YLARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLLPAKHNLNAPDT 523

Human   482 YNDSVDPRIANVF-TNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLEGGIDP 545
            |:..|||.|||.| ..|||:.|||: |.:|.:.......|   .:.|.::.|..:.:..|.|||.
  Fly   524 YDPEVDPSIANCFAAAAFRFAHTLL-PGLFNISRDNSTPE---AIELHKMLFNPFSLWAEHGIDH 584

Human   546 ILRGLMATPAKLNRQNQIAVD-----EIRERLFE-----QVMRIGLDLPALNMQRSRDHGLPGYN 600
            .|.....||.       :.||     |:.::|||     :|...||||.:||:||.||||:|.|.
  Fly   585 ALMTAANTPV-------MQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDHGIPSYP 642

Human   601 AWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACII 665
            .:||.|.||..:|..::...:.|..| ..:.:.|.:|.::|::.|.:|||.......||||:|::
  Fly   643 VFRRHCRLPTVDTWEEMSQAIDNATL-DSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCMV 706

Human   666 GTQFRKLRDGDRFWWENE---GVFSMQQRQALAQISLPRIICDNT-GITTVSKNNIFMSNSYPRD 726
            ..||.:|:.||..|:|.:   ..|:..|...:.:.||..|||.|: |||.|.::.:.........
  Fly   707 SDQFLRLKLGDSHWYERKMGPQKFTKAQLAEIYKTSLAAIICRNSDGITRVREHVMQRLRDGGNP 771

Human   727 FVNCSTLPA--LNLASWRE 743
            .|:|..|..  .|...|.|
  Fly   772 HVDCQDLEGFHFNFEPWSE 790

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MPONP_000241.1 myeloperoxidase_like 316..728 CDD:188656 157/439 (36%)
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 204/571 (36%)
peroxinectin_like 364..750 CDD:188655 149/405 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.