DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dgt1 and AT2G31600

Sequence 1:NP_001287595.1 Gene:dgt1 FlyBaseID:FBgn0039710 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_001318328.1 Gene:AT2G31600 AraportID:AT2G31600 Length:301 Species:Arabidopsis thaliana

Alignment Length:307 Identity:67/308 (22%)
Similarity:115/308 (37%) Gaps:83/308 (27%)


  Fly   195 YASDSSSNDA-----DPPCLRNTAQDIEFYESDHESID------SEDDDPLKHAGVFTRAEAVKI 248
            |:|.::|..|     ..|.:||:..:.....|...|..      |::|:.|..:...||:|.:|.
plant    22 YSSGAASTTAVASTSAEPLIRNSTLNPNPSTSGLPSTSNSPITMSQEDEILARSSHITRSELLKR 86

  Fly   249 AETKLIKLQGLYREQISYLQNVLRQRRRKY--LHDIRRERELYCSIHDQLKDTPHERKLYEQLKA 311
            ....|.:|...||:....|...::.:.|.|  .:.|           .|.||..::         
plant    87 RSHNLKQLAKCYRDNYWALMEDVKAQHRDYWWKYGI-----------SQFKDENNQ--------- 131

  Fly   312 LNSYHRRQGVEAVLYKKLKEKRARDALYAAKSSSNPKCVFTEGGVK---------------CGER 361
             ::..||.|.|..:         .|...|.:.|.:.  |....|||               |..:
plant   132 -SNKRRRLGQEGDI---------GDGGDAVEGSGDN--VTNNDGVKSDQYANSNCGSCMYGCKAK 184

  Fly   362 TLPCCKHCRKHILEDKRQVLFRACG--VERS---GVVCQEPVASILEDSSCVLHLTVAPAKRQYI 421
            .:...|:|:.|||:|.:|.|:..|.  ::|:   .::|.:|..:....:.|.:|...|   ::::
plant   185 AMALTKYCQLHILKDSKQKLYTGCTNVIKRAPAGPLLCGKPTLASTVPALCNIHFQKA---QKHV 246

  Fly   422 QKF-----YEVPST---PPVESIFAAGRGLDNFVG--EDPRNEPQPE 458
            .|.     :.|.||   ||...:..|.     ||.  :..|..||.|
plant   247 AKALKDAGHNVSSTSKPPPKLHVIVAA-----FVHHIQAKRKNPQKE 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dgt1NP_001287595.1 zf-C3Hc3H 42..107 CDD:290602
zf-C3Hc3H 349..411 CDD:290602 19/82 (23%)
AT2G31600NP_001318328.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13453
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.