DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dgt1 and Kansl2

Sequence 1:NP_001287595.1 Gene:dgt1 FlyBaseID:FBgn0039710 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_001346756.1 Gene:Kansl2 MGIID:1916862 Length:486 Species:Mus musculus

Alignment Length:538 Identity:174/539 (32%)
Similarity:252/539 (47%) Gaps:108/539 (20%)


  Fly    42 CANPTYECSLMRIEGYEYCIRHILRDPRSNFRQCSHVYS-NGRKCINAVAKYDNKKELILTTLCF 105
            |:.....||..|:||.|:||:|||.|..:.|:|||:|.: ||::|.:|..|.:.|..:   :.|.
Mouse    28 CSFTHRPCSQPRLEGQEFCIKHILEDKNAPFKQCSYVSTKNGKRCPSAAPKPEKKDGV---SFCA 89

  Fly   106 EHNRQTQL----QKTHMNVGRIRSRVETNETLLHSLSSHINVEDIKPEVKKIERDDDEIDVVSPH 166
            ||.|:..|    |....|.|.:      .||||..|||:...|                      
Mouse    90 EHARRNALALHAQMKKSNPGPM------GETLLCQLSSYAKTE---------------------- 126

  Fly   167 VTPFVTQDHRNSIG-HVVESSR-KRRRILDYASDS-SSNDADPPCLRNTAQDIEFYESDHESIDS 228
                        :| ...|||| :..||||  .|| |..|.:|..:..|.:...  :|:.:||||
Mouse   127 ------------LGSQTPESSRSEASRILD--EDSWSDGDQEPITVDQTWRGDP--DSEADSIDS 175

  Fly   229 EDDDPLKHAGVFTRAEAVKIAETKLIKLQGLYREQISYLQNVLRQRRRKYLHDIRRERELYCSIH 293
            :.:||||||||:|..|...|...|||:||.||.:|...||::|::::|:|||:.:.|.|   ::.
Mouse   176 DQEDPLKHAGVYTAEEVALIMREKLIRLQSLYIDQFKRLQHLLKEKKRRYLHNRKVEHE---ALG 237

  Fly   294 DQLKDTPH-----ERKLYEQLKALNSYHRRQGVEAVLYKKLKEKR--ARD--ALYAAKSSSNPKC 349
            ..|...|.     ||:..::||.|..|.:|.||||:|:::|||:|  |.|  |..|..:.|:.:|
Mouse   238 SSLLTGPEGLLAKERENLKRLKCLRRYRQRYGVEALLHRQLKERRMLATDGAAQQAHTTRSSQRC 302

  Fly   350 VFTEGGVKCGERTLPCCKHCRKHILEDKRQVLFRAC-GVERSGVVCQEPV-ASILEDSSCVLHLT 412
            :.....|:|..::||..:||..||.:|..||||:.| |.|.  |.|.:|| .|:.||..|.||..
Mouse   303 LAFVDDVRCSNQSLPMTRHCLTHICQDTNQVLFKCCQGSEE--VPCNKPVPVSLSEDPCCPLHFQ 365

  Fly   413 VAPAKRQYIQKFYEVPSTP------PVESIFAAGRGLDNFVGEDPRNEPQPEGDDLLDFANGIFD 471
            :.|    .:.|..:|.|.|      |::...:|.             |.||.....|:|::    
Mouse   366 LPP----QMYKPEQVLSVPDDLEAGPMDLYLSAA-------------ELQPTESLPLEFSD---- 409

  Fly   472 FDLDGVDDLANSLDDDYSMFLDMDSDLGLAIEDDGVESDPVDLG-LEEEGDGGSNDSVGPAESQA 535
             |||.|.|   .:....|..|   .|..|.:||..|.....|.| ::..|||..:......|..|
Mouse   410 -DLDVVGD---GMPCPPSPLL---FDPSLTLEDHSVTESAGDAGQMQAAGDGCRSQGARSVEKAA 467

  Fly   536 --QDNLIADNFELEEPSV 551
              |..|...|.:.|..|:
Mouse   468 FPQRGLATANGKPEPTSI 485

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dgt1NP_001287595.1 zf-C3Hc3H 42..107 CDD:290602 26/66 (39%)
zf-C3Hc3H 349..411 CDD:290602 27/64 (42%)
Kansl2NP_001346756.1 zf-C3Hc3H 28..92 CDD:316414 27/67 (40%)
zf-C3Hc3H 307..364 CDD:316414 26/59 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C258193978
eggNOG 1 0.900 E1_2CC1T
Hieranoid 1 1.000
Homologene 1 1.000 H32367
Inparanoid 1 1.050 181 1.000 Inparanoid score I3955
Isobase 1 0.950 0 Normalized mean entropy S7628
OMA 1 1.010
OrthoDB 1 1.010 D172254at2759
OrthoFinder 1 1.000 FOG0005706
OrthoInspector 1 1.000 T1082200
orthoMCL 1 0.900 OOG5_134127
Panther 1 1.100 LDO PTHR13453
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5324
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.