DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dgt1 and ino80db

Sequence 1:NP_001287595.1 Gene:dgt1 FlyBaseID:FBgn0039710 Length:589 Species:Drosophila melanogaster
Sequence 2:XP_009300512.1 Gene:ino80db ZFINID:ZDB-GENE-070112-2072 Length:847 Species:Danio rerio

Alignment Length:726 Identity:144/727 (20%)
Similarity:245/727 (34%) Gaps:252/727 (35%)


  Fly    30 EQIH-SELVKIKYCANPTYECSLMRIEGYEYCIRHILRDPRSNFRQCSHVYS-NGRKCINAVAKY 92
            :.|| ||:.....|:.....|...|:.||.:||||:|.|..:.||||.:|.. |.::|.|.:.|.
Zfish     5 KHIHYSEVDHKPLCSYSPKLCKQRRLNGYAFCIRHVLEDRTAPFRQCEYVAKYNSQRCTNPIPKA 69

  Fly    93 DNKKELILTTLCFEHNRQTQLQKTHMNVGRIRSRVETNETLLHSLSSHINVEDIKPEVKKIERDD 157
            ..:|      .|..|     ||.  |.|...:.|.:..:| :.||:.:|.|..:      ..:..
Zfish    70 HERK------YCNSH-----LQV--MGVLPKKERKKKQDT-IESLALNITVPSL------ALKTH 114

  Fly   158 DEIDVVSPHVTPFVT-------------------------------------QDHRNSIGHVVES 185
            :.::::.|...|.:.                                     |||.....|:..|
Zfish   115 NGLEILPPSPPPALVCLLPSDPFAFYKEEKMFKSSGAFLKKPQETLNHKQKQQDHSVDANHLRTS 179

  Fly   186 SRKRR------------RILDYASDSSSNDADPPCLRN-----TAQDI-EFYESDHESIDSEDDD 232
            |....            |......:.||..|..|.:|:     |:..: :.::...:|.|::...
Zfish   180 SLPSTLSHSCLPPLLTGRATQTPINPSSPRAATPTVRSGSLFKTSSSLQDTHQGSKDSTDNKIKL 244

  Fly   233 PLKHAGVFTR---------AEAVKIAETKLIKLQGLYREQ----ISYLQNVLRQRRRKYLHDIR- 283
            .|.||  |.:         |......:::|||...:..:|    :..|..::.|.:.:: .|:. 
Zfish   245 DLNHA--FDKKVVPAASGMAPCCDDTQSRLIKKCTVAMQQQAPCLKKLHRLMDQHKGRF-QDLNS 306

  Fly   284 -------------RERE-------LYCSIHDQLKDTPHERKLYEQLKALNSYHRRQGVEAVLYKK 328
                         .|.|       .|.....|.|.:...|...|:|....||.|::.:.....::
Zfish   307 HLACVPGLDWSEDSEEEDGDWKLVSYQCQRLQEKRSEESRSRAERLAGFCSYLRQKHMHLCREQR 371

  Fly   329 --LKEKRARDALYAA--------------------KSSSNPK-------------CVFTEGGVKC 358
              .:|:|::.||..|                    :.:|.|.             |.....|..|
Zfish   372 GFRRERRSQHALRKALVQAAREEPHQTAQLIQEQHQVTSAPSSTAVSLAGDDSGLCQAVVKGENC 436

  Fly   359 GERTLPCCKHCRKHILEDKRQVLFRACGVE-RSGVVCQEPVASILEDSS-CVLHLTVAPAKR--- 418
            ....||..:||.:|||:::.|.||.:|... ..|..|..||..|...:. |..|     ||:   
Zfish   437 RNSALPFTRHCFQHILQNRSQQLFSSCTARFADGAQCSIPVFDITHQTPLCDEH-----AKKMDN 496

  Fly   419 --------------QYIQKFYEV-PSTPPVESIFAAGRGLDNFVGEDPRNEPQ-------PEGDD 461
                          |.||:...: .:.||..|.....:|     ....:..||       |:|: 
Zfish   497 FLRGDISRRTYHHHQQIQRHRPLKKAKPPALSKKHKKKG-----KRGTQRRPQKPIPPALPQGN- 555

  Fly   462 LLDFANGIFDFDLDGVDDLANSLDDDYSMFLDMDSDLGLAIEDDGVESDPV--DLGLEEEGDGGS 524
                                          |.:.|.|.|..:..|:.| |:  ||..:|..|..:
Zfish   556 ------------------------------LALPSILCLPSQPSGIRS-PLTPDLSADEFPDDIT 589

  Fly   525 NDSVGPAESQAQDNLIAD---NFELEE-------PSVQDNNELNFDIDESESN--------VNEV 571
            ||             |:|   :.||.:       |.:.|:.: :||:.|.:::        ..|:
Zfish   590 ND-------------ISDIPHDLELNQEDFSDVLPRLPDDLQ-DFDLFEGKNSELLPTSEEAEEL 640

  Fly   572 LRLLEGIEHMP 582
            :|:|:.:...|
Zfish   641 VRVLQAMGSYP 651

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dgt1NP_001287595.1 zf-C3Hc3H 42..107 CDD:290602 22/66 (33%)
zf-C3Hc3H 349..411 CDD:290602 21/64 (33%)
ino80dbXP_009300512.1 zf-C3Hc3H 18..79 CDD:290602 23/72 (32%)
zf-C3Hc3H 432..491 CDD:290602 20/64 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D172254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.