DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dgt1 and INO80D

Sequence 1:NP_001287595.1 Gene:dgt1 FlyBaseID:FBgn0039710 Length:589 Species:Drosophila melanogaster
Sequence 2:XP_011509671.1 Gene:INO80D HGNCID:25997 Length:1056 Species:Homo sapiens

Alignment Length:757 Identity:144/758 (19%)
Similarity:242/758 (32%) Gaps:305/758 (40%)


  Fly    49 CSLMRIEGYEYCIRHILRDPRSNFRQCSHVYS-NGRKCINAVAKYDNKK--ELILTTLCFEHNRQ 110
            |...|:.||.:||||:|.|..:.|:||.:|.. |.::|.|.:.|.::::  ...|..|.|...::
Human    54 CKQRRLNGYAFCIRHVLEDKTAPFKQCEYVAKYNSQRCTNPIPKSEDRRYCNSHLQVLGFIPKKE 118

  Fly   111 TQLQKTHMNVGRIRSRVETN------ETLLHSLSSHINVEDIKPEVKKI---------------- 153
            .:.:...::..::|.:::|.      .||...:.:.::...:.|...::                
Human   119 RKKKNDPIDEVKVRHQMDTMAFSLTVPTLALKMPNGLDGMSLSPPGARVPLHYLETELEDPFAFN 183

  Fly   154 ERDDD-----------------------EIDVV-------SP--------------HVTPFVT-- 172
            |.|||                       |.:::       ||              |::|..|  
Human   184 EEDDDLKKGATVRKKLQSKLAQNRQRQRETEILKVRQEHFSPPPAPSQQQPPQQHSHLSPLSTSL 248

  Fly   173 --------------QDHRNSI--------GHVVESSRK--RRRILDYASDSSSNDADPP------ 207
                          |....|:        .|.:..:|:  .:|.|.....|.:...|||      
Human   249 KPPAPPQGSVCKSPQPQNTSLPMQGVAPTTHTIAQARQLSHKRPLPLLPSSRAPTVDPPRTDRIL 313

  Fly   208 ----------------------CLRNTAQDIEFY---------ESDHESIDSEDDDPL------- 234
                                  |.:....|.:.:         ||..|..|||...|.       
Human   314 MKATAFSPHFSCISRLQRLVKLCTQKHQLDTDLFPHLGLDWSEESGEEPEDSEQASPYQVAWSIR 378

  Fly   235 ------KHAGVFTRAEAVKIAETKLIKLQGLYREQISYLQNVLR--QRRRKYLHDIRR------E 285
                  :||.....||:   ..:::.:|...::::..:|..:.|  .|::|..|..|:      .
Human   379 ETLRYQRHASDDDDAES---RSSRVTQLCTYFQQKYKHLCRLERAESRQKKCRHTFRKALLQAAS 440

  Fly   286 RELYCSIHDQLKDTPHERKLYEQLKALNSYHRRQGVEAVLYKKLKEKRARDALYAAKSSSNPKCV 350
            :|..|:           .:|.::|       ||.........:.|.:....|          .|.
Human   441 KEPECT-----------GQLIQEL-------RRAACSRTSISRTKLREVEPA----------ACS 477

  Fly   351 FTEGGVKCGERTLPCCKHCRKHILEDKRQVLFRACGVE-RSGVVCQEPVASIL------------ 402
            .|..|.:|..:.||..:||.:|||.:..|.||.:|..: ..|..|..||..|.            
Human   478 GTVKGEQCANKALPFTRHCFQHILLNHSQQLFSSCTAKFADGQQCSVPVFDITHQTPLCEEHAKK 542

  Fly   403 -------EDSSCVLH--------LTVAPA-------KRQYIQKFYEVPSTP-------------- 431
                   ::|..|.|        .|..||       ||:...:..:.|..|              
Human   543 MDNFLRGDNSRKVQHQQQRKPRKKTKPPALTKKHKKKRRRGPRRPQKPIPPAVPQGNLSMPASVS 607

  Fly   432 -PVESIFAAGRGLDNFVGEDPRNEPQPEGDDLL-DFANGIFDF--DLD-GVDDLANSL----DD- 486
             |||:...          ..| :.|:...|:|. |.||.|.|.  ||: ..:|.::.|    || 
Human   608 LPVEASHI----------RSP-STPELSADELPDDIANEITDIPHDLELNQEDFSDVLPRLPDDL 661

  Fly   487 -DYSMF--------------------------LDMDSDLGLAIEDDGVESDPVD------LGLEE 518
             |:..|                          |:..|.:|:..:.|||   ||.      :|:..
Human   662 QDFDFFEGKNGDLLPTTEEAEELERALQAVTSLECLSTIGVLAQSDGV---PVQELSDRGIGVFS 723

  Fly   519 EGDGGS---------NDSVGPAESQAQDNLIADNF---ELEE 548
            .|.|.|         |..:|   ......::.|||   ||:|
Human   724 TGTGASGIQSLSREVNTDLG---ELLNGRIVHDNFSSLELDE 762

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dgt1NP_001287595.1 zf-C3Hc3H 42..107 CDD:290602 21/61 (34%)
zf-C3Hc3H 349..411 CDD:290602 23/90 (26%)
INO80DXP_011509671.1 zf-C3Hc3H 50..108 CDD:290602 18/54 (33%)
zf-C3Hc3H 476..540 CDD:290602 20/64 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D172254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.