DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dgt1 and Ino80d

Sequence 1:NP_001287595.1 Gene:dgt1 FlyBaseID:FBgn0039710 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_001178738.1 Gene:Ino80d RGDID:1304808 Length:1021 Species:Rattus norvegicus

Alignment Length:749 Identity:153/750 (20%)
Similarity:250/750 (33%) Gaps:255/750 (34%)


  Fly    30 EQIH-SELVKIKYCANPTYECSLMRIEGYEYCIRHILRDPRSNFRQCSHVYS-NGRKCINAVAKY 92
            :.|| ||:.....|:.....|...|:.||.:||||:|.|..:.|:||.:|.. |.::|.|.:.|.
  Rat     5 KHIHFSEVDNKPLCSYSPKLCKQRRLNGYAFCIRHVLEDKTAPFKQCEYVAKYNSQRCTNPIPKS 69

  Fly    93 DNKK--ELILTTLCFEHNRQTQLQKTHMNVGRIRSRVE------TNETLLHSLSSHINVEDIKPE 149
            ::::  ...|..|.|...::.:.:...::..::|.:::      |..||...:.:.::...:.|.
  Rat    70 EDRRYCNSHLQVLGFIPKKERKKKNDPVDEVKVRHQMDAMAFSLTVPTLALKMPNGLDSMSLSPP 134

  Fly   150 VKKI----------------ERDDD-----------------------EIDVVS----------- 164
            ..::                |.|||                       |.:::.           
  Rat   135 GARVPLHYLETELEDPFAFNEEDDDLKKGVTVRKKLQSKLAQNRQRQRETEILKVRQEHFSTPPT 199

  Fly   165 -----PHVTPFVT----------------QDHRNSI--------GHVVESSRK--RRRILDYASD 198
                 .|::|..|                |....|:        .|.:..:|:  .:|.|.....
  Rat   200 PPQQHAHLSPLPTSLKPPAPPQGSVCKSPQPQSTSLPMQGVAPTTHSIAQTRQASHKRPLPLLPS 264

  Fly   199 SSSNDADPP-----------------CLRNTAQDIEFYESDHESIDSEDDDPLKHAGVFTRAEAV 246
            |.:..:|.|                 |:....:.::.....|:.    |.|...|.|:....|:.
  Rat   265 SRAPVSDTPRTDRILMKATAFSPHFSCISRLQRLVKLCTQKHQL----DADLFPHLGLDWSEESG 325

  Fly   247 KIAETKLIKLQGLYREQISYLQ------NVLRQRRRKYLHDIRRERE----LYCSIHDQLKDTPH 301
            :..|..         :|.|..|      ..|||.|.....|....|.    ..|:...|  ...|
  Rat   326 EELEDS---------DQASPYQVAWSVRETLRQERHTSDDDDAESRSSRVTQLCTYFQQ--KYKH 379

  Fly   302 ----ERKLYEQLKALNSYHRRQGVEAVLYKKLKE-----------KRA---RDALYAAK-SSSNP 347
                ||....|.|..:::.:     |:|....||           :||   ||:|...| ....|
  Rat   380 LCRLERAESRQKKCRHTFRK-----ALLQAASKEPECTGQLIQELRRAACSRDSLSQTKLKEVEP 439

  Fly   348 -KCVFTEGGVKCGERTLPCCKHCRKHILEDKRQVLFRACGVE-RSGVVCQEPVASIL-------- 402
             .|..|..|.:|..:.||..:||.:|||.::.|.||.:|..: ..|..|..||..|.        
  Rat   440 AACSGTVKGEQCTNQALPFTRHCFQHILLNRSQQLFSSCTAKFADGQQCSVPVFDITHQTPLCEE 504

  Fly   403 -----------EDSSCVLH--------LTVAPA-KRQYIQKFYEVPSTP--PVESIFAAGR-GLD 444
                       ::|..|.|        .|..|| .:::.:|....|..|  |:......|. .:.
  Rat   505 HAKKMDNFLRGDNSRKVQHQQQRKPRKKTKPPALTKKHKKKRRRGPRRPQKPIPPAVPQGNLSMP 569

  Fly   445 NFVG--------EDPRNEPQPEGDDLL-DFANGIFDF--DLD-GVDDLANSL----DD--DYSMF 491
            ..|.        ..| :.|:...|:|. |.||.|.|.  ||: ..:|.|:.|    ||  |:..|
  Rat   570 TSVSLPVQASQIRSP-STPELSADELPDDIANEITDIPHDLELNQEDFADVLPRLPDDLQDFDFF 633

  Fly   492 --------------------------LDMDSDLGLAIEDDGVESDPVDLGLEEEGDG---GSNDS 527
                                      |:..|.:|:..:.|||   ||. ||.:.|.|   ...|:
  Rat   634 EGKNGDLLPTTEEAEELERALQAVTSLECLSTIGVLSQSDGV---PVQ-GLSDRGMGVFSTGTDA 694

  Fly   528 VGPAESQAQDN----------LIADNF---ELEE 548
            .|......:.|          ::.|:|   ||:|
  Rat   695 SGIQSLSREVNTDLGELLNGRIVHDSFSSLELDE 728

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dgt1NP_001287595.1 zf-C3Hc3H 42..107 CDD:290602 22/68 (32%)
zf-C3Hc3H 349..411 CDD:290602 23/90 (26%)
Ino80dNP_001178738.1 zf-C3Hc3H 18..79 CDD:290602 19/61 (31%)
Spc29 166..>278 CDD:293687 13/112 (12%)
zf-C3Hc3H 442..506 CDD:290602 20/64 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D172254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.