DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dgt1 and Kansl2

Sequence 1:NP_001287595.1 Gene:dgt1 FlyBaseID:FBgn0039710 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_001004244.2 Gene:Kansl2 RGDID:1303127 Length:488 Species:Rattus norvegicus

Alignment Length:515 Identity:164/516 (32%)
Similarity:242/516 (47%) Gaps:108/516 (21%)


  Fly    42 CANPTYECSLMRIEGYEYCIRHILRDPRSNFRQCSHVYS-NGRKCINAVAKYDNKKELILTTLCF 105
            |:.....||..|:||.|:|::|||.|..:.|:|||::.: ||::|.:|..|.:.|..:   :.|.
  Rat    28 CSFTHRPCSQPRLEGQEFCLKHILEDKNAPFKQCSYISTKNGKRCPSAAPKPEKKDGV---SFCA 89

  Fly   106 EHNRQTQL----QKTHMNVGRIRSRVETNETLLHSLSSHINVEDIKPEVKKIERDDDEIDVVSPH 166
            ||.|:..|    |....|.|.:      .||||..|||:...|                      
  Rat    90 EHARRNALALHAQMKKSNPGPM------GETLLCQLSSYAKTE---------------------- 126

  Fly   167 VTPFVTQDHRNSIG-HVVESSR-KRRRILDYASDS-SSNDADPPCLRNTAQDIEFYESDHESIDS 228
                        :| ...|||| :..||||  .|| |..|.:|..:..|.:...  :|:.:||||
  Rat   127 ------------LGSQTPESSRSEASRILD--EDSWSDGDQEPITVDQTWRGDP--DSEADSIDS 175

  Fly   229 EDDDPLKHAGVFTRAEAVKIAETKLIKLQGLYREQISYLQNVLRQRRRKYLHDIRRERELYCSIH 293
            :.:||||||||:|..|...|...|||:||.||.:|...||::|::::|:|||:.:.|.|   ::.
  Rat   176 DQEDPLKHAGVYTAEEVALIMREKLIRLQSLYIDQFKRLQHLLKEKKRRYLHNRKVEHE---ALG 237

  Fly   294 DQLKDTPH-----ERKLYEQLKALNSYHRRQGVEAVLYKKLKEKRARDALYAAKSS----SNPKC 349
            ..|...|.     ||:..::||.|..|.:|.||||:|:::|||:|......||:.:    |:.:|
  Rat   238 SSLLTGPEGLLAKERENLKRLKCLRRYRQRYGVEALLHRQLKERRMLATEGAAQQAHTTRSSQRC 302

  Fly   350 VFTEGGVKCGERTLPCCKHCRKHILEDKRQVLFRAC-GVERSGVVCQEPV-ASILEDSSCVLHLT 412
            :.....|:|..::||..:||..||.:|..||||:.| |.|.  |.|.:|| .|:.||..|.||..
  Rat   303 LAFVDDVRCSNQSLPMTRHCLTHICQDTNQVLFKCCQGSEE--VPCNKPVPVSLSEDPCCPLHFQ 365

  Fly   413 VAPAKRQYIQKFYEVPSTP------PVESIFAAGRGLDNFVGEDPRNEPQPEGDDLLDFANGIFD 471
            :.|    .:.|..:|.|.|      |::...:|.             |.||.....|:.::    
  Rat   366 LPP----QMYKPEQVLSVPDGLEAGPMDLYLSAA-------------ELQPTESLPLELSD---- 409

  Fly   472 FDLDGVDDLANSLDDDYSMFLDMDSDLGLAIEDDGVESDPVDLG-LEEEGDGGSNDSVGP 530
             |||.|.|   .:....|..|   .|..|.:||..|.......| ::..|||..  |.||
  Rat   410 -DLDVVGD---GMPCPPSPLL---FDPSLTLEDHSVTEIAGGPGQIQVAGDGCR--SQGP 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dgt1NP_001287595.1 zf-C3Hc3H 42..107 CDD:290602 24/66 (36%)
zf-C3Hc3H 349..411 CDD:290602 27/64 (42%)
Kansl2NP_001004244.2 zf-C3Hc3H 28..92 CDD:290602 25/67 (37%)
zf-C3Hc3H 307..364 CDD:290602 26/59 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C258190883
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H32367
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005706
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13453
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.