DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dgt1 and LOC110440037

Sequence 1:NP_001287595.1 Gene:dgt1 FlyBaseID:FBgn0039710 Length:589 Species:Drosophila melanogaster
Sequence 2:XP_021334490.1 Gene:LOC110440037 ID: Length:922 Species:Danio rerio

Alignment Length:765 Identity:151/766 (20%)
Similarity:236/766 (31%) Gaps:306/766 (40%)


  Fly    30 EQIH-SELVKIKYCANPTYECSLMRIEGYEYCIRHILRDPRSNFRQCSHVYS-NGRKCINAVAKY 92
            :.|| ||:.....|:.....|...|:.||.:||||:|.|..:.|:||.:|.. |.::|.|.:.|.
Zfish     5 KHIHFSEVDNKPLCSYSPKLCKQRRLNGYAFCIRHVLEDKTAPFKQCEYVAKYNSQRCTNPIPKA 69

  Fly    93 DNKKELILTTLCFEHNR------QTQLQKTHMNVGRIRSRVETNETLLHSLSSHINVED-----I 146
            :.::      .|..|.:      :.:.:|....:..:|||.......|:.....:.:.|     .
Zfish    70 EERR------YCNSHLQVLGFIPKKERKKKQDGLEEVRSRAHVESVALNITVPSLALRDTNGLPA 128

  Fly   147 KPEVKKIE----RDDDEIDVVSPHVTPFVTQDHRNSIGHVVESSRKRRRILDYASDSSSNDADPP 207
            .|...::.    .|.|.:|       ||...:..:.    ||.|..:|.....:|...::.....
Zfish   129 SPPCSRLTPMPLLDSDLLD-------PFAFYEEDSD----VEESLLQRPAQRSSSKRKASSTPVI 182

  Fly   208 CLRNTAQ----DIEFYESDHESI-----------------------------------------D 227
            .||.||:    |||.:.:..||.                                         :
Zfish   183 GLRVTARDLEPDIEHFSAVTESCTLPSSPPPPPPSPPQPSQHTERPTYAPLGTVQTLLCKPAPPE 247

  Fly   228 SEDDDPLKHAG--------------------------VFTRAEAVKIAETKLIKLQGLYR----- 261
            |....||..||                          |..|..|.......|::||.|.:     
Zfish   248 SASSVPLPPAGLQNQPVIWRPASPRPLSAHDCPQPRSVALRPAAFTAPPVCLLRLQHLVQLYANR 312

  Fly   262 -------------------------------------------EQISYLQNVLRQRRR------- 276
                                                       .|.|.....|.:|.|       
Zfish   313 QREHGDLFPHLGLDWSEDSADDEDTEELVPLLPQAWRLQERSPHQSSSSDKPLSRRARLAQLCSY 377

  Fly   277 ---KYLHDIRRERELYCSIHDQLKDTPHERKLYEQLKA-LNSYHRRQGVEAVLYKKLKEKRARDA 337
               :|.|..||:|..          :.|.|..|...|| |::..:.....|.|.:||  .|:...
Zfish   378 LQERYKHLCRRDRAA----------SRHSRYRYAFRKALLHAASKDPDCTAQLIQKL--SRSSQT 430

  Fly   338 LYAAKSSSNPK-----CVFTEGGVKCGERTLPCCKHCRKHILEDKRQVLFRACGVE-RSGVVCQE 396
            ...::|::..|     |..:..|..|....||..:||.:|||.::.|.||.:|... ..|..|..
Zfish   431 SSCSRSAAPHKYERTACTGSTKGQSCSNTALPFSRHCFQHILLNRSQQLFSSCTARFADGQQCSV 495

  Fly   397 PVASILEDSSCVLHLTVAPAKRQYIQKFYEVPSTPPVESIFAAGRGLDNFVGED----------- 450
            ||..|       .|.|  |...::.:|                   :|||:..|           
Zfish   496 PVFDI-------THQT--PLCDEHAKK-------------------MDNFLRGDGHRRSQQQQQR 532

  Fly   451 -PRNE--------------------PQ-------PEGDDLLDFAN-----------GIFDFDLDG 476
             ||.:                    ||       |:|:.|:...:           ...:...|.
Zfish   533 RPRKKTKPPALTKKHKKKRRRGPRRPQKPIPPAVPQGNLLMPSLSLPTHHAHVRSPSTPELSADE 597

  Fly   477 V-DDLANSLDDDYSMFLDMDSDLGLAIED--DGVESDPVDLGLEEEGDGGSNDSVGPAESQAQDN 538
            : ||:||.:.       |:.:||.|..||  |.:...|.||                     || 
Zfish   598 LPDDIANEMP-------DIPNDLELNQEDFSDVLPRLPDDL---------------------QD- 633

  Fly   539 LIADNFELEEPSVQDNNELNFDIDESESNVNEVLRLLEGIEHMPWFDALM 588
                 |:|.|..   |.||....:|:|    |::|.|:.:...|  |:|:
Zfish   634 -----FDLFEGK---NGELLPTTEEAE----ELVRALQAMGSYP--DSLV 669

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dgt1NP_001287595.1 zf-C3Hc3H 42..107 CDD:290602 20/66 (30%)
zf-C3Hc3H 349..411 CDD:290602 20/63 (32%)
LOC110440037XP_021334490.1 zf-C3Hc3H 18..79 CDD:316414 21/67 (31%)
zf-C3Hc3H 450..511 CDD:316414 21/70 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D172254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.