DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dgt1 and LOC103690317

Sequence 1:NP_001287595.1 Gene:dgt1 FlyBaseID:FBgn0039710 Length:589 Species:Drosophila melanogaster
Sequence 2:XP_008764075.1 Gene:LOC103690317 RGDID:9332946 Length:488 Species:Rattus norvegicus

Alignment Length:515 Identity:164/516 (32%)
Similarity:242/516 (47%) Gaps:108/516 (21%)


  Fly    42 CANPTYECSLMRIEGYEYCIRHILRDPRSNFRQCSHVYS-NGRKCINAVAKYDNKKELILTTLCF 105
            |:.....||..|:||.|:|::|||.|..:.|:|||::.: ||::|.:|..|.:.|..:   :.|.
  Rat    28 CSFTHRPCSQPRLEGQEFCLKHILEDKNAPFKQCSYISTKNGKRCPSAAPKPEKKDGV---SFCA 89

  Fly   106 EHNRQTQL----QKTHMNVGRIRSRVETNETLLHSLSSHINVEDIKPEVKKIERDDDEIDVVSPH 166
            ||.|:..|    |....|.|.:      .||||..|||:...|                      
  Rat    90 EHARRNALALHAQMKKSNPGPM------GETLLCQLSSYAKTE---------------------- 126

  Fly   167 VTPFVTQDHRNSIG-HVVESSR-KRRRILDYASDS-SSNDADPPCLRNTAQDIEFYESDHESIDS 228
                        :| ...|||| :..||||  .|| |..|.:|..:..|.:...  :|:.:||||
  Rat   127 ------------LGSQTPESSRSEASRILD--EDSWSDGDQEPITVDQTWRGDP--DSEADSIDS 175

  Fly   229 EDDDPLKHAGVFTRAEAVKIAETKLIKLQGLYREQISYLQNVLRQRRRKYLHDIRRERELYCSIH 293
            :.:||||||||:|..|...|...|||:||.||.:|...||::|::::|:|||:.:.|.|   ::.
  Rat   176 DQEDPLKHAGVYTAEEVALIMREKLIRLQSLYIDQFKRLQHLLKEKKRRYLHNRKVEHE---ALG 237

  Fly   294 DQLKDTPH-----ERKLYEQLKALNSYHRRQGVEAVLYKKLKEKRARDALYAAKSS----SNPKC 349
            ..|...|.     ||:..::||.|..|.:|.||||:|:::|||:|......||:.:    |:.:|
  Rat   238 SSLLTGPEGLLAKERENLKRLKCLRRYRQRYGVEALLHRQLKERRMLATEGAAQQAHTTRSSQRC 302

  Fly   350 VFTEGGVKCGERTLPCCKHCRKHILEDKRQVLFRAC-GVERSGVVCQEPV-ASILEDSSCVLHLT 412
            :.....|:|..::||..:||..||.:|..||||:.| |.|.  |.|.:|| .|:.||..|.||..
  Rat   303 LAFVDDVRCSNQSLPMTRHCLTHICQDTNQVLFKCCQGSEE--VPCNKPVPVSLSEDPCCPLHFQ 365

  Fly   413 VAPAKRQYIQKFYEVPSTP------PVESIFAAGRGLDNFVGEDPRNEPQPEGDDLLDFANGIFD 471
            :.|    .:.|..:|.|.|      |::...:|.             |.||.....|:.::    
  Rat   366 LPP----QMYKPEQVLSVPDGLEAGPMDLYLSAA-------------ELQPTESLPLELSD---- 409

  Fly   472 FDLDGVDDLANSLDDDYSMFLDMDSDLGLAIEDDGVESDPVDLG-LEEEGDGGSNDSVGP 530
             |||.|.|   .:....|..|   .|..|.:||..|.......| ::..|||..  |.||
  Rat   410 -DLDVVGD---GMPCPPSPLL---FDPSLTLEDHSVTEIAGGPGQIQVAGDGCR--SQGP 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dgt1NP_001287595.1 zf-C3Hc3H 42..107 CDD:290602 24/66 (36%)
zf-C3Hc3H 349..411 CDD:290602 27/64 (42%)
LOC103690317XP_008764075.1 zf-C3Hc3H 28..92 CDD:290602 25/67 (37%)
zf-C3Hc3H 307..364 CDD:290602 26/59 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C258195137
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3855
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D172254at2759
OrthoFinder 1 1.000 FOG0005706
OrthoInspector 1 1.000 T1085803
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.