DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dgt1 and kansl2

Sequence 1:NP_001287595.1 Gene:dgt1 FlyBaseID:FBgn0039710 Length:589 Species:Drosophila melanogaster
Sequence 2:NP_001096493.1 Gene:kansl2 XenbaseID:XB-GENE-972363 Length:500 Species:Xenopus tropicalis

Alignment Length:563 Identity:172/564 (30%)
Similarity:258/564 (46%) Gaps:141/564 (25%)


  Fly    43 ANPTYECSLM-------RIEGYEYCIRHILRDPRSNFRQCSHVYS-NGRKCINAVAKYDNKKELI 99
            ||.|..||..       ||||:::||:|||.|..:.::|||::.: |||:|.||..|.|.|..: 
 Frog    22 ANETLSCSFTHRPCSQPRIEGHDFCIKHILEDRNAPYKQCSYISTKNGRRCSNAAPKPDKKDGV- 85

  Fly   100 LTTLCFEHNR------QTQLQKTHMNVGRIRSRVETNETLLHSLSSHINVEDIKPEVKKIERDDD 158
              :.|.||.|      |.|::|:  |.|      .|:|:||:.|:::.                 
 Frog    86 --SFCAEHARRNALALQAQIKKS--NPG------PTSESLLYQLNTYA----------------- 123

  Fly   159 EIDVVSPHVTPFVTQDHRNSIG-HVVESSRKRR-RILDYASDS-SSNDADPPCLRNTAQ-DIEFY 219
                             |:.:| .:.||||... ||||  .|| |.:|.|...:..|.: |:   
 Frog   124 -----------------RSELGSQIQESSRSEACRILD--EDSLSESDQDTVTVDQTWRGDL--- 166

  Fly   220 ESDHESIDSEDDDPLKHAGVFTRAEAVKIAETKLIKLQGLYREQISYLQNVLRQRRRKYLHDIRR 284
            :|:.:|:||:.:||||||||:|..|...|...|||:||.||.:|...||::|::::|.|||.::.
 Frog   167 DSEADSLDSDQEDPLKHAGVYTAEEVTLIMREKLIRLQSLYIDQFKRLQHLLKEKKRNYLHTLKT 231

  Fly   285 ERELYCSIHDQLKD-----TPHERKLYEQLKALNSYHRRQGVEAVLYKKLKEKR------ARDAL 338
            |.|   ::...|..     |..||:...:||||..|.:|.||||:|:::|||:|      |....
 Frog   232 EHE---TVGSSLLTGSEGLTFKERECLRRLKALRRYRKRYGVEALLHRQLKERRMLASEGASQQA 293

  Fly   339 YAAKSSSNPKCVFTEGGVKCGERTLPCCKHCRKHILEDKRQVLFRAC-GVERSGVVCQEPV-ASI 401
            :..:||.  :|:.....|:|....||..:||..||.:|..||||:.| |.|  .|.|.:|| .|:
 Frog   294 HTTRSSQ--RCMAFIDDVRCSNSCLPMTRHCVSHICQDSSQVLFKLCSGSE--DVACNKPVPLSL 354

  Fly   402 LEDSSCVLHLTVAPAKRQYIQKFYEVP---STPPVESIFAAGRGLDNFVGEDPRNEPQPEGDDLL 463
            .|:..|:||..: |:.....:....||   ...|||...:..             |.||..:..|
 Frog   355 SEEPCCLLHYRL-PSPMYKAEPVLPVPEPMDVTPVELYLSTA-------------ELQPTENLPL 405

  Fly   464 DFANGIFDFDL--DGVD------------DLANSLD-DDYSMFLDMDSDLGLAIEDDGVESDPVD 513
            :|::   |.|:  ||:.            |::..|| .:|.....|.|.| |...|..|      
 Frog   406 EFSD---DLDVVGDGMQFPPSPLLFDPSADISRPLDSQEYEKHRTMASHL-LLTADSLV------ 460

  Fly   514 LGLEEEGDGGSNDSVGPAESQAQDNL-IADNFELEEPSVQDNN 555
                  |..|.    |..::.|..:| :.||......|..:.|
 Frog   461 ------GSAGQ----GQVQTAAASSLHLTDNATESSLSTPNGN 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dgt1NP_001287595.1 zf-C3Hc3H 42..107 CDD:290602 29/72 (40%)
zf-C3Hc3H 349..411 CDD:290602 26/64 (41%)
kansl2NP_001096493.1 zf-C3Hc3H 28..92 CDD:316414 27/67 (40%)
zf-C3Hc3H 307..363 CDD:316414 24/58 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C258190764
eggNOG 1 0.900 E1_2CC1T
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H32367
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D172254at2759
OrthoFinder 1 1.000 FOG0005706
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.