DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7834 and CIR1

Sequence 1:NP_651727.1 Gene:CG7834 FlyBaseID:FBgn0039697 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_011723.1 Gene:CIR1 SGDID:S000003439 Length:261 Species:Saccharomyces cerevisiae

Alignment Length:252 Identity:116/253 (46%)
Similarity:171/253 (68%) Gaps:7/253 (3%)


  Fly     3 RVLVGVKRVIDYAVKVRVKPDKTGVVTQGVKHSMNPFDEIAVEEAVKLKE--KKLAEEVIAVSVG 65
            |:||.||||:|:.:|.||....||:.|.|:|.|:||||:||||||:::||  |.|.|...|||:|
Yeast     8 RILVPVKRVVDFQIKPRVNKTLTGIETSGIKFSINPFDDIAVEEAIRIKEKNKSLVESTHAVSIG 72

  Fly    66 PAQSQEVIRTALAMGADRGVHVEIPAAEYELLQPIHVSKILAKLALDEKADLVILGKQAIDDDAN 130
            .|::|:::|..||.|.|....::  :...|.::|:.::|||..:...:.::||::||||||||.|
Yeast    73 SAKAQDILRNCLAKGIDTCSLID--SVGKENIEPLAIAKILKAVVEKKGSNLVLMGKQAIDDDCN 135

  Fly   131 QTAQMTAAVLDWPQGTFCNKIEKTDAG-LTITREIDGGLETIKTKTPAVLSADLRLNTPRYATLP 194
            .|.||.|.:|:|||.|...|:|..|.| :.:|||||.|.|.|:...|.|::.|||||||||..||
Yeast   136 NTGQMLAGLLNWPQATNAAKVEFLDNGRVQVTREIDDGEEVIEASLPMVITTDLRLNTPRYVGLP 200

  Fly   195 NIMKAKKKPLKKV-TAKDL-GVDTSPRIEVISVEDPPVRQAGATVADVDALVAKLKE 249
            .:|||||||::|: .|||. .::..|:::::|:|:|..:..|..:..||.|:.||||
Yeast   201 KLMKAKKKPIEKLDIAKDFPEINIEPQLKIVSMEEPKTKSPGVKLNSVDELIEKLKE 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7834NP_651727.1 FixA 3..249 CDD:224997 115/251 (46%)
CIR1NP_011723.1 FixA 7..261 CDD:224997 116/253 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C211152269
eggNOG 1 0.900 E1_COG2086
Hieranoid 1 1.000
Homologene 1 1.000 H1503
Inparanoid 1 1.050 220 1.000 Inparanoid score I760
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004311
OrthoInspector 1 1.000 T1135796
orthoMCL 1 0.900 OOG5_127708
Panther 1 1.100 LDO PTHR21294
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R419
TreeFam 1 0.960
1211.880

Return to query results.
Submit another query.