DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7834 and ETFBETA

Sequence 1:NP_651727.1 Gene:CG7834 FlyBaseID:FBgn0039697 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001332757.1 Gene:ETFBETA AraportID:AT5G43430 Length:282 Species:Arabidopsis thaliana

Alignment Length:253 Identity:145/254 (57%)
Similarity:186/254 (73%) Gaps:6/254 (2%)


  Fly     3 RVLVGVKRVIDYAVKVRVKPDKTGVVTQGVKHSMNPFDEIAVEEAVKLKEKKLAEEVIAVSVGPA 67
            ::||.||||:|||||:|||||||||.||.||.|||||.|||:|||:::||...|:||||||:||:
plant    33 KILVAVKRVVDYAVKIRVKPDKTGVETQNVKMSMNPFCEIALEEALRIKEAGFAKEVIAVSIGPS 97

  Fly    68 QSQEVIRTALAMGADRGVHVEIPAAEYELLQPIHVSKILAKLALDEKADLVILGKQAIDDDANQT 132
            |..:.:||.||||||||:|||..:    :..|:.::|||..||..|...|:.|||||||||.|||
plant    98 QCVDTLRTGLAMGADRGIHVETNS----IFLPLTIAKILKSLADVENPGLIFLGKQAIDDDCNQT 158

  Fly   133 AQMTAAVLDWPQGTFCNKI--EKTDAGLTITREIDGGLETIKTKTPAVLSADLRLNTPRYATLPN 195
            .||.||:|.|||.||.:|:  :|.....|:.||:||||||:....|||::.|||||.||||:|||
plant   159 GQMVAALLGWPQATFASKVVLDKDKNVATVDREVDGGLETLNVDLPAVITTDLRLNQPRYASLPN 223

  Fly   196 IMKAKKKPLKKVTAKDLGVDTSPRIEVISVEDPPVRQAGATVADVDALVAKLKEGGHI 253
            |||||.||:||:|.:||.||....||::.|.:||.|::|..|:.||.|:.|||...|:
plant   224 IMKAKSKPIKKMTVQDLKVDIKSDIEILEVTEPPKRKSGVMVSSVDELIDKLKNEAHV 281

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7834NP_651727.1 FixA 3..249 CDD:224997 144/248 (58%)
ETFBETANP_001332757.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H1503
Inparanoid 1 1.050 286 1.000 Inparanoid score I831
OMA 1 1.010
OrthoDB 1 1.010 D1092876at2759
OrthoInspector 1 1.000 T192482
orthoMCL 1 0.900 OOG5_127708
Panther 1 1.100 LDO PTHR21294
Phylome 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.