DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7834 and etfb

Sequence 1:NP_651727.1 Gene:CG7834 FlyBaseID:FBgn0039697 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_998163.1 Gene:etfb ZFINID:ZDB-GENE-040426-1931 Length:254 Species:Danio rerio

Alignment Length:252 Identity:180/253 (71%)
Similarity:203/253 (80%) Gaps:0/253 (0%)


  Fly     2 ARVLVGVKRVIDYAVKVRVKPDKTGVVTQGVKHSMNPFDEIAVEEAVKLKEKKLAEEVIAVSVGP 66
            ||||||||||||||||:|||||.|||||.|||||||||.|||||||||||||||.:||:|||.||
Zfish     3 ARVLVGVKRVIDYAVKIRVKPDHTGVVTDGVKHSMNPFCEIAVEEAVKLKEKKLIKEVVAVSCGP 67

  Fly    67 AQSQEVIRTALAMGADRGVHVEIPAAEYELLQPIHVSKILAKLALDEKADLVILGKQAIDDDANQ 131
            .|.||.||||||||||||:|||:...:||.|.|:.||||||.||..|:|.|:||||||||||.||
Zfish    68 QQVQETIRTALAMGADRGIHVEVSGKDYETLGPLQVSKILAALAKKEEASLIILGKQAIDDDCNQ 132

  Fly   132 TAQMTAAVLDWPQGTFCNKIEKTDAGLTITREIDGGLETIKTKTPAVLSADLRLNTPRYATLPNI 196
            |.|||||:||||||||.:::......|.:.|||||||||||.|.|||::||||||||||||||||
Zfish   133 TGQMTAALLDWPQGTFASELAFEADKLKVVREIDGGLETIKIKLPAVVTADLRLNTPRYATLPNI 197

  Fly   197 MKAKKKPLKKVTAKDLGVDTSPRIEVISVEDPPVRQAGATVADVDALVAKLKEGGHI 253
            ||||||.:..|...|||||.|.|:||:.|::||.||||..|..|:.||.||||.|.:
Zfish   198 MKAKKKKIAMVKPADLGVDVSSRLEVLKVDEPPTRQAGVKVETVEDLVGKLKEAGRV 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7834NP_651727.1 FixA 3..249 CDD:224997 177/246 (72%)
etfbNP_998163.1 FixA 4..252 CDD:224997 178/248 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C211144292
eggNOG 1 0.900 E1_COG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H1503
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1092876at2759
OrthoFinder 1 1.000 FOG0004311
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127708
Panther 1 1.100 LDO PTHR21294
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.