DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7834 and etfb

Sequence 1:NP_651727.1 Gene:CG7834 FlyBaseID:FBgn0039697 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_989154.1 Gene:etfb XenbaseID:XB-GENE-956098 Length:254 Species:Xenopus tropicalis

Alignment Length:251 Identity:175/252 (69%)
Similarity:199/252 (79%) Gaps:0/252 (0%)


  Fly     3 RVLVGVKRVIDYAVKVRVKPDKTGVVTQGVKHSMNPFDEIAVEEAVKLKEKKLAEEVIAVSVGPA 67
            |.|||||||||||||||||||||||||.|||||||||.||||||||:|||||:..|:||||.||.
 Frog     4 RALVGVKRVIDYAVKVRVKPDKTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKIVSEIIAVSCGPQ 68

  Fly    68 QSQEVIRTALAMGADRGVHVEIPAAEYELLQPIHVSKILAKLALDEKADLVILGKQAIDDDANQT 132
            |.||.||||||||||||:|||:.|.:.|.|.|..||||:|.||..|..:||::||||||||.|||
 Frog    69 QCQETIRTALAMGADRGIHVEVAAKDAESLGPFQVSKIMAALAKKENVNLVLMGKQAIDDDCNQT 133

  Fly   133 AQMTAAVLDWPQGTFCNKIEKTDAGLTITREIDGGLETIKTKTPAVLSADLRLNTPRYATLPNIM 197
            .|||||:||||||||.::::.....||:.||:|||||||..|.|||::||||||.||||||||||
 Frog   134 GQMTAALLDWPQGTFASEVKVEGEKLTVVREVDGGLETISVKLPAVVTADLRLNEPRYATLPNIM 198

  Fly   198 KAKKKPLKKVTAKDLGVDTSPRIEVISVEDPPVRQAGATVADVDALVAKLKEGGHI 253
            |||||.::.|...|||||.:.||.|:||||||.|.||..|..|..||:||||.|.|
 Frog   199 KAKKKKIETVKPSDLGVDITSRIRVLSVEDPPQRLAGVKVETVQDLVSKLKESGRI 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7834NP_651727.1 FixA 3..249 CDD:224997 172/246 (70%)
etfbNP_989154.1 FixA 3..254 CDD:224997 174/250 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C211144417
eggNOG 1 0.900 E1_COG2086
Hieranoid 1 1.000
Homologene 1 1.000 H1503
Inparanoid 1 1.050 341 1.000 Inparanoid score I2182
OMA 1 1.010
OrthoDB 1 1.010 D1092876at2759
OrthoFinder 1 1.000 FOG0004311
OrthoInspector 1 1.000 T1058904
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R419
TreeFam 1 0.960
1110.890

Return to query results.
Submit another query.