DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7834 and SPAC1805.02c

Sequence 1:NP_651727.1 Gene:CG7834 FlyBaseID:FBgn0039697 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_593913.1 Gene:SPAC1805.02c PomBaseID:SPAC1805.02c Length:254 Species:Schizosaccharomyces pombe

Alignment Length:251 Identity:112/252 (44%)
Similarity:160/252 (63%) Gaps:5/252 (2%)


  Fly     3 RVLVGVKRVIDYAVKVRVKPDKTGVVTQGVKHSMNPFDEIAVEEAVKLKE--KKLAEEVIAVSVG 65
            |:||||||.:||.:|.|:...||.|...|.|.|:|||.:||||||:::||  |...|:.:.|:.|
pombe     5 RILVGVKRTLDYMLKPRINATKTAVDLSGQKMSINPFCDIAVEEAIRMKETLKNRIEDTLVVTAG 69

  Fly    66 PAQSQEVIRTALAMGADRGVHVEIPAAEYELLQPIHVSKILAKLALDEKADLVILGKQAIDDDAN 130
            ...|:.::|..||.|..|...:.:...|   |:|:.|:|:|......||::||:||||||||||:
pombe    70 QTSSEPILRQCLAKGIGRAALINVGEKE---LEPLSVAKLLKATVEKEKSNLVLLGKQAIDDDAH 131

  Fly   131 QTAQMTAAVLDWPQGTFCNKIEKTDAGLTITREIDGGLETIKTKTPAVLSADLRLNTPRYATLPN 195
            ||..|.||:|.|||.|..:|:......:.:|||||||.||:.:..||:::.|||||.||:|.|..
pombe   132 QTGGMLAAMLGWPQFTSASKVRIEGDKVIVTREIDGGEETLSSTLPAIITTDLRLNVPRFANLAK 196

  Fly   196 IMKAKKKPLKKVTAKDLGVDTSPRIEVISVEDPPVRQAGATVADVDALVAKLKEGG 251
            :|||:|.||.|::.:||||....|::.:||.:|..::....|..||.:|..|||.|
pombe   197 VMKARKAPLGKMSPEDLGVTIDQRLQTVSVSEPVQKRQNIMVKSVDEMVKTLKELG 252

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7834NP_651727.1 FixA 3..249 CDD:224997 110/248 (44%)
SPAC1805.02cNP_593913.1 FixA 5..254 CDD:224997 112/252 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H1503
Inparanoid 1 1.050 212 1.000 Inparanoid score I929
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004311
OrthoInspector 1 1.000 T1124579
orthoMCL 1 0.900 OOG5_127708
Panther 1 1.100 LDO PTHR21294
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R419
TreeFam 1 0.960
1010.050

Return to query results.
Submit another query.