DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7834 and ETFB

Sequence 1:NP_651727.1 Gene:CG7834 FlyBaseID:FBgn0039697 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001014763.1 Gene:ETFB HGNCID:3482 Length:346 Species:Homo sapiens

Alignment Length:239 Identity:163/240 (68%)
Similarity:190/240 (79%) Gaps:0/240 (0%)


  Fly    15 AVKVRVKPDKTGVVTQGVKHSMNPFDEIAVEEAVKLKEKKLAEEVIAVSVGPAQSQEVIRTALAM 79
            |.::|||||:|||||.|||||||||.||||||||:||||||.:||||||.||||.||.|||||||
Human   108 AGQIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALAM 172

  Fly    80 GADRGVHVEIPAAEYELLQPIHVSKILAKLALDEKADLVILGKQAIDDDANQTAQMTAAVLDWPQ 144
            |||||:|||:|.||.|.|.|:.|:::|||||..||.|||:|||||||||.|||.||||..|||||
Human   173 GADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQ 237

  Fly   145 GTFCNKIEKTDAGLTITREIDGGLETIKTKTPAVLSADLRLNTPRYATLPNIMKAKKKPLKKVTA 209
            |||.:::......|.:.|||||||||::.|.|||::||||||.|||||||||||||||.::.:..
Human   238 GTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKP 302

  Fly   210 KDLGVDTSPRIEVISVEDPPVRQAGATVADVDALVAKLKEGGHI 253
            .|||||.:.::.||||||||.|.||..|...:.|||||||.|.|
Human   303 GDLGVDLTSKLSVISVEDPPQRTAGVKVETTEDLVAKLKEIGRI 346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7834NP_651727.1 FixA 3..249 CDD:224997 160/234 (68%)
ETFBNP_001014763.1 ETF_beta 110..301 CDD:238847 136/191 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C211143653
eggNOG 1 0.900 E1_COG2086
Hieranoid 1 1.000
Homologene 1 1.000 H1503
Inparanoid 1 1.050 342 1.000 Inparanoid score I2310
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1092876at2759
OrthoFinder 1 1.000 FOG0004311
OrthoInspector 1 1.000 T1072795
orthoMCL 1 0.900 OOG5_127708
Panther 1 1.100 LDO PTHR21294
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R419
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.