DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7834 and F23C8.5

Sequence 1:NP_651727.1 Gene:CG7834 FlyBaseID:FBgn0039697 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_490973.2 Gene:F23C8.5 WormBaseID:WBGene00017734 Length:255 Species:Caenorhabditis elegans

Alignment Length:252 Identity:164/253 (65%)
Similarity:200/253 (79%) Gaps:1/253 (0%)


  Fly     3 RVLVGVKRVIDYAVKVRVKPDKTGVVTQGVKHSMNPFDEIAVEEAVKLKEKKLAEEVIAVSVGPA 67
            ::|||||||:|||||:|||||::||||:||:||||||||||:||||||||||||.||:|.|:|..
 Worm     2 KILVGVKRVVDYAVKIRVKPDRSGVVTEGVQHSMNPFDEIALEEAVKLKEKKLATEVVAFSLGGP 66

  Fly    68 QSQEVIRTALAMGADRGVHVEIPAAEYELLQPIHVSKILAKLALDEKADLVILGKQAIDDDANQT 132
            :|.||:|||||.|||:.|||::..||...|:..||:|.|.|:...||.|.|.|||||||||::||
 Worm    67 KSAEVLRTALAKGADKAVHVQVTDAEAGKLESFHVAKALQKIVEQEKFDAVFLGKQAIDDDSSQT 131

  Fly   133 AQMTAAVLDWPQGTFCNKIEKTDAG-LTITREIDGGLETIKTKTPAVLSADLRLNTPRYATLPNI 196
            |.:.|.:|:|||..:.:|:|...|| :.:||||||||:|||.|.|.|||||||||.|||||||||
 Worm   132 APILAGLLEWPQALYASKVEDAGAGHMKVTREIDGGLDTIKVKVPFVLSADLRLNEPRYATLPNI 196

  Fly   197 MKAKKKPLKKVTAKDLGVDTSPRIEVISVEDPPVRQAGATVADVDALVAKLKEGGHI 253
            |||||||||.:..|||.||.:|:.|.:.|.:|||||||..|.||.||||||||.|.:
 Worm   197 MKAKKKPLKNIPIKDLNVDITPQTETLEVTEPPVRQAGGFVDDVSALVAKLKEKGFV 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7834NP_651727.1 FixA 3..249 CDD:224997 162/247 (66%)
F23C8.5NP_490973.2 FixA 1..254 CDD:224997 164/253 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C210813238
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H1503
Inparanoid 1 1.050 324 1.000 Inparanoid score I1447
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1092876at2759
OrthoFinder 1 1.000 FOG0004311
OrthoInspector 1 1.000 T474429
orthoMCL 1 0.900 OOG5_127708
Panther 1 1.100 LDO PTHR21294
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R419
TreeFam 00.000 Not matched by this tool.
1111.030

Return to query results.
Submit another query.