DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7834 and Etfb

Sequence 1:NP_651727.1 Gene:CG7834 FlyBaseID:FBgn0039697 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_080971.2 Gene:Etfb MGIID:106098 Length:255 Species:Mus musculus

Alignment Length:251 Identity:171/252 (68%)
Similarity:202/252 (80%) Gaps:0/252 (0%)


  Fly     3 RVLVGVKRVIDYAVKVRVKPDKTGVVTQGVKHSMNPFDEIAVEEAVKLKEKKLAEEVIAVSVGPA 67
            |.||.||||||:|||:||||||:||||.|||||||||.||||||||:||||||.:|:||||.||:
Mouse     5 RALVAVKRVIDFAVKIRVKPDKSGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEIIAVSCGPS 69

  Fly    68 QSQEVIRTALAMGADRGVHVEIPAAEYELLQPIHVSKILAKLALDEKADLVILGKQAIDDDANQT 132
            |.||.||||||||||||:|||||.|:.|.|.|:.|:::|||||..||.||:.|||||||||.|||
Mouse    70 QCQETIRTALAMGADRGIHVEIPGAQAESLGPLQVARVLAKLAEKEKVDLLFLGKQAIDDDCNQT 134

  Fly   133 AQMTAAVLDWPQGTFCNKIEKTDAGLTITREIDGGLETIKTKTPAVLSADLRLNTPRYATLPNIM 197
            .||||.:||||||||.:::......:.:.|||||||||::.|.|||::||||||.||||||||||
Mouse   135 GQMTAGLLDWPQGTFASQVTLEGDKVKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIM 199

  Fly   198 KAKKKPLKKVTAKDLGVDTSPRIEVISVEDPPVRQAGATVADVDALVAKLKEGGHI 253
            |||||.::.|.|.|||||.:.::.|||||:||.|.||..|...:.|||||||.|.|
Mouse   200 KAKKKKIEVVKAGDLGVDLTSKVSVISVEEPPQRSAGVKVETTEDLVAKLKEVGRI 255

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7834NP_651727.1 FixA 3..249 CDD:224997 168/246 (68%)
EtfbNP_080971.2 ETF_beta 5..210 CDD:238847 145/205 (71%)
Recognition loop. {ECO:0000250|UniProtKB:P38117} 183..205 21/22 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C211143097
eggNOG 1 0.900 E1_COG2086
Hieranoid 1 1.000
Homologene 1 1.000 H1503
Inparanoid 1 1.050 337 1.000 Inparanoid score I2362
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004311
OrthoInspector 1 1.000 T615871
orthoMCL 1 0.900 OOG5_127708
Panther 1 1.100 LDO PTHR21294
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R419
TreeFam 1 0.960
1211.880

Return to query results.
Submit another query.