DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7601 and CG31937

Sequence 1:NP_651717.1 Gene:CG7601 FlyBaseID:FBgn0027583 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster

Alignment Length:278 Identity:88/279 (32%)
Similarity:151/279 (54%) Gaps:24/279 (9%)


  Fly    17 VLYWVLGTVLMPVALPLAIINIWQRFQAQKFRNQLPGKVVLITGASSGLGESLAHVFYRAGCRVI 81
            |||:|: .||:.:.|...:. :|.:.:.....:.:.|:||.|||||||:|.:||....|.|.:::
  Fly    12 VLYYVV-YVLLWILLDCNVA-LWYKSRFGVSLSSMRGQVVWITGASSGIGRALALSLARHGVKLV 74

  Fly    82 LAARRTQELERVKKDLLAL--------DVDPAYPPTVLPLDLAELNSIPEFVTRVLAVYNQVDIL 138
            |:|||.::||:|:::.||.        ||      .|:.:|:.:|:.....:..||..::::|:|
  Fly    75 LSARRLEQLEQVQEECLAAARGLLATKDV------LVIQMDMLDLDEHKTHLNTVLNHFHRLDVL 133

  Fly   139 INNGGISVRADVASTAVDVDLKVMVVNYFGSVALTKALLPSMVKR--GSGHICFISSVQGKFAIP 201
            :||.|.|.||......::||.::..::.|..|.|::.::...|::  |.|||...||:.|...:|
  Fly   134 VNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGFSPVP 198

  Fly   202 QRAAYSASKHAMQAFADSLRAEVANKNINVSCVSPGYIRTQLSLNALTGSGSSYGKVDETTA--K 264
            ....|.|:|||:.|:..||:.|:  :.::||..:||.|.|.....|.|||..  |||..:||  |
  Fly   199 FSPTYCAAKHALNAYLLSLKVEM--RKLDVSLFAPGPIATDFLQEAFTGSQG--GKVGLSTANQK 259

  Fly   265 GMSPDKLAERILQCILRK 282
            .|:..:..:.....:..|
  Fly   260 RMTAQRCGDLFAVALANK 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7601NP_651717.1 11beta-HSD1_like_SDR_c 51..310 CDD:187593 80/245 (33%)
PRK06181 53..314 CDD:235726 80/243 (33%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 80/245 (33%)
adh_short 47..245 CDD:278532 69/206 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104003295
eggNOG 1 0.900 E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D429842at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.