DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99d and Obp69a

DIOPT Version :8

Sequence 1:NP_651712.1 Gene:Obp99d / 43496 FlyBaseID:FBgn0039684 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_524039.2 Gene:Obp69a / 39411 FlyBaseID:FBgn0011279 Length:148 Species:Drosophila melanogaster

Alignment Length:76 Identity:14/77 (18%)
Similarity:33/77 (43%) Gaps:15/77 (19%)


  Fly     7 EIICWSCLLIAMAVSTEAASVWKLPT-AQMVYEDLEK--------CRQESQEE--DAA--TLRCL 58
            ||.|:...:..|....::.::..|.. .:::.|::.|        |..:..::  |.|  |::|.
  Fly    67 EIKCFLYCMFDMFGLIDSQNIMHLEALLEVLPEEIHKTINGLVSSCGTQKGKDGCDTAYETVKCY 131

  Fly    59 VKKLG--LWTD 67
            :...|  :|.:
  Fly   132 IAVNGKFIWEE 142

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp99dNP_651712.1 PBP_GOBP <38..116 CDD:279703 9/45 (20%)
Obp69aNP_524039.2 PBP_GOBP 26..133 CDD:279703 12/66 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11857
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.