DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99d and Obp56a

DIOPT Version :10

Sequence 1:NP_651712.1 Gene:Obp99d / 43496 FlyBaseID:FBgn0039684 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_611442.1 Gene:Obp56a / 37264 FlyBaseID:FBgn0034468 Length:139 Species:Drosophila melanogaster


Alignment Length:132 Identity:28/132 - (21%)
Similarity:48/132 - (36%) Gaps:27/132 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IICWSCLLIAMAVSTEAASVWKLPTAQ--MVYEDLEKCRQE---SQEEDAAT------------- 54
            :|..|.|.:.:||    .|...|...|  :..:..|:|.:|   ::||.|..             
  Fly     6 VIALSALFVTLAV----GSSLNLSDEQKDLAKQHREQCAEEVKLTEEEKAKVNAKDFNNPTENIK 66

  Fly    55 --LRCLVKKLGLWTDESGYNARRIAKIFAGHNQMEELMLVVEHCNRMEQDTSHLDDWAFLAYRCA 117
              ..|..:|:|...|.....:..:.|:.|...: |:....:|.|..::.:..  .|.|...|.|.
  Fly    67 CFANCFFEKVGTLKDGELQESVVLEKLGALIGE-EKTKAALEKCRTIKGENK--CDTASKLYDCF 128

  Fly   118 TS 119
            .|
  Fly   129 ES 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99dNP_651712.1 PBP_GOBP <38..116 CDD:460193 18/95 (19%)
Obp56aNP_611442.1 PBP_GOBP 24..128 CDD:460193 20/106 (19%)

Return to query results.
Submit another query.