DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99d and Obp56a

DIOPT Version :8

Sequence 1:NP_651712.1 Gene:Obp99d / 43496 FlyBaseID:FBgn0039684 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_611442.1 Gene:Obp56a / 37264 FlyBaseID:FBgn0034468 Length:139 Species:Drosophila melanogaster

Alignment Length:132 Identity:28/133 (21%)
Similarity:48/133 (36%) Gaps:27/133 (20%)


  Fly     8 IICWSCLLIAMAVSTEAASVWKLPTAQ--MVYEDLEKCRQE---SQEEDAAT------------- 54
            :|..|.|.:.:||    .|...|...|  :..:..|:|.:|   ::||.|..             
  Fly     6 VIALSALFVTLAV----GSSLNLSDEQKDLAKQHREQCAEEVKLTEEEKAKVNAKDFNNPTENIK 66

  Fly    55 --LRCLVKKLGLWTDESGYNARRIAKIFAGHNQMEELMLVVEHCNRMEQDTSHLDDWAFLAYRCA 117
              ..|..:|:|...|.....:..:.|:.|...: |:....:|.|..::.:..  .|.|...|.|.
  Fly    67 CFANCFFEKVGTLKDGELQESVVLEKLGALIGE-EKTKAALEKCRTIKGENK--CDTASKLYDCF 128

  Fly   118 TS 119
            .|
  Fly   129 ES 130

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp99dNP_651712.1 PBP_GOBP <38..116 CDD:279703 18/96 (19%)
Obp56aNP_611442.1 PBP_GOBP 24..128 CDD:279703 21/107 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11857
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.