DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99d and Obp8a

DIOPT Version :10

Sequence 1:NP_651712.1 Gene:Obp99d / 43496 FlyBaseID:FBgn0039684 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster


Alignment Length:113 Identity:35/113 - (30%)
Similarity:51/113 - (45%) Gaps:16/113 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KLPTAQMVYEDLEKCRQESQEEDAATLR----CLVKKLGLWTDESGYNARRIAKIFAGHNQM--E 87
            :|..||.:..|      ..|.||||.:|    |...:|.||.||:|:.|:||.:.|.|..::  |
  Fly    50 ELTAAQRLQLD------RMQFEDAAHVRHYLHCFWSRLQLWLDETGFQAQRIVQSFGGERRLNVE 108

  Fly    88 ELMLVVEHCNRMEQD----TSHLDDWAFLAYRCATSGQFGHWVKDFMS 131
            :.:..:..||.....    ...:.||.|.|:.|..:...|.|.|..||
  Fly   109 QALPAINGCNAKTSSRGSGAQTVVDWCFRAFVCVLATPVGEWYKRHMS 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99dNP_651712.1 PBP_GOBP <38..116 CDD:460193 26/87 (30%)
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 30/99 (30%)

Return to query results.
Submit another query.