DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99d and Obp56f

DIOPT Version :10

Sequence 1:NP_651712.1 Gene:Obp99d / 43496 FlyBaseID:FBgn0039684 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_725926.1 Gene:Obp56f / 246668 FlyBaseID:FBgn0043533 Length:125 Species:Drosophila melanogaster


Alignment Length:72 Identity:14/72 - (19%)
Similarity:33/72 - (45%) Gaps:5/72 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QMVYEDLEKCRQESQEEDAAT---LRCLVKKLGLWTDE--SGYNARRIAKIFAGHNQMEELMLVV 93
            |:.|...|..:.:::|:...:   ..||::..|:..::  |....|::.:...|....:||....
  Fly    33 QLGYTITENTKFDAKEDSLQSKCFYHCLLEVKGVIANDAISSEQPRKVLEKKYGITDTDELEKAE 97

  Fly    94 EHCNRME 100
            |.|:.::
  Fly    98 EKCHSIK 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99dNP_651712.1 PBP_GOBP <38..116 CDD:460193 12/68 (18%)
Obp56fNP_725926.1 PBP_GOBP <49..120 CDD:460193 10/56 (18%)

Return to query results.
Submit another query.