DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99d and Obp51a

DIOPT Version :8

Sequence 1:NP_651712.1 Gene:Obp99d / 43496 FlyBaseID:FBgn0039684 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_725436.1 Gene:Obp51a / 246666 FlyBaseID:FBgn0043530 Length:117 Species:Drosophila melanogaster

Alignment Length:133 Identity:26/134 (19%)
Similarity:53/134 (40%) Gaps:59/134 (44%)


  Fly    14 LLIAMAVSTEAASVWKLPTAQMVYEDLEKCRQESQEEDAATLRCLVKKLGLWTD--ESGYNARRI 76
            |::.:||:|.:::::                 ||:..:.|      ||||:..|  |:..::.|:
  Fly     7 LVLLLAVTTLSSALF-----------------ESEANECA------KKLGITPDYFENFPHSSRV 48

  Fly    77 AKIFAGHNQMEELMLV--------------------------VEHCNRMEQDTSHLD--DWAFLA 113
            ...:  |.|||:|.::                          |:.|.::    ||.|  :..:|.
  Fly    49 KCFY--HCQMEKLEIIANGVVTPFDLKVLNISPESYDKYGVKVKPCLKL----SHRDKCELGYLV 107

  Fly   114 YRC 116
            ::|
  Fly   108 FQC 110

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp99dNP_651712.1 PBP_GOBP <38..116 CDD:279703 21/108 (19%)
Obp51aNP_725436.1 PBP_GOBP 25..114 CDD:279703 20/99 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11857
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.