DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99c and Obp56i

DIOPT Version :10

Sequence 1:NP_651711.1 Gene:Obp99c / 43494 FlyBaseID:FBgn0039682 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_725929.1 Gene:Obp56i / 246667 FlyBaseID:FBgn0043532 Length:140 Species:Drosophila melanogaster


Alignment Length:119 Identity:19/119 - (15%)
Similarity:37/119 - (31%) Gaps:31/119 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKYLIVALALCAVAHADDWTPKTGEEIRKIRVDCLKENPLSNDQISQLKNLIFPNEPDVRQYLTC 66
            |..::|.|..|.|            :...|:..|:....::...::.......|.. .|:.:..|
  Fly     9 LLLVVVTLPTCFV------------QAGPIKDQCMAAAGITAQDVANRHETDDPGH-SVKCFFRC 60

  Fly    67 SAIKLGIFCDQQ----------GY--------HADRLAKQFKMDLSEEEALQIA 102
            ....:||..|.|          |:        ..:......|.:.|.:|:.:.|
  Fly    61 FLENIGIIADNQIIPGAFDRVLGHIVTAEAVERMEATCNMIKSETSHDESCEFA 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99cNP_651711.1 PBP_GOBP 19..128 CDD:460193 14/102 (14%)
Obp56iNP_725929.1 PBP_GOBP 25..121 CDD:460193 14/91 (15%)

Return to query results.
Submit another query.