DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99c and Obp51a

DIOPT Version :10

Sequence 1:NP_651711.1 Gene:Obp99c / 43494 FlyBaseID:FBgn0039682 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_725436.1 Gene:Obp51a / 246666 FlyBaseID:FBgn0043530 Length:117 Species:Drosophila melanogaster


Alignment Length:43 Identity:10/43 - (23%)
Similarity:18/43 - (41%) Gaps:5/43 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DCLKENPLSNDQISQLKNLIFPNEPDVRQYLTCSAIKLGIFCD 76
            :|.|:..::.|....     ||:...|:.:..|...||.|..:
  Fly    27 ECAKKLGITPDYFEN-----FPHSSRVKCFYHCQMEKLEIIAN 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99cNP_651711.1 PBP_GOBP 19..128 CDD:460193 10/43 (23%)
Obp51aNP_725436.1 PBP_GOBP 21..111 CDD:467938 10/43 (23%)

Return to query results.
Submit another query.