DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1907 and OAC1

Sequence 1:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_012802.1 Gene:OAC1 SGDID:S000001603 Length:324 Species:Saccharomyces cerevisiae

Alignment Length:329 Identity:107/330 (32%)
Similarity:157/330 (48%) Gaps:25/330 (8%)


  Fly     2 SATSVQEAPKKAVATNAI----KFLFGGLSGMGATMVVQPLDLVKTRMQISG--AGSGKKEYRSS 60
            |..|.|:...:..|...|    .|:.|||:...|..|..|::|:|.|||:.|  :.|..|.|::.
Yeast     3 SDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNP 67

  Fly    61 LHCIQTIVSKEGPLALYQGIGAALLRQATYTTGRLGMY----TYLNDLF---REKFQ-RSPGITD 117
            :..:..|...||...|.:|:.||.:.|......|||.|    :.||.||   :|..: :|.|:  
Yeast    68 IQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGV-- 130

  Fly   118 SMAMGTIAGACGAFIGTPAEVALVRMTSDGR-LPVAERRNYTNVANALARITREEGLTALWRGSL 181
            ::..|..:|..||.||:|..:...|:.|... :.:.|:.:||.|.|.|..|.:.||:..|:||..
Yeast   131 NVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGID 195

  Fly   182 PTVGRAMVVNMTQLASYSQFKTYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQN 246
            ..:.|....:..||..|:..|.......| |::|..||..||.:|||...:...|.|:..|||.|
Yeast   196 AAILRTGAGSSVQLPIYNTAKNILVKNDL-MKDGPALHLTASTISGLGVAVVMNPWDVILTRIYN 259

  Fly   247 MKMVDGKPEYRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQ---LNQGYNKYV 308
            .|    ...|:|..|.|::..|.|||.||:|||.....|:.|||::....:||   |.......|
Yeast   260 QK----GDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSIESRV 320

  Fly   309 LGSN 312
            ||.|
Yeast   321 LGHN 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 34/106 (32%)
Mito_carr 118..207 CDD:278578 26/90 (29%)
Mito_carr 219..307 CDD:278578 33/91 (36%)
OAC1NP_012802.1 Mito_carr 26..294 CDD:332982 91/275 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R857
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.