DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1907 and Slc25a14

Sequence 1:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_006257593.1 Gene:Slc25a14 RGDID:621433 Length:344 Species:Rattus norvegicus

Alignment Length:312 Identity:102/313 (33%)
Similarity:166/313 (53%) Gaps:19/313 (6%)


  Fly     2 SATSVQEAPKKAVATNAIK------FLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKK----E 56
            |:..:::..|.:..::.:.      |::|||:.:.|.....|:||.|||:|:.|.....:    :
  Rat    38 SSAELEQHQKSSALSHEMSGLNWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDVRFKEIK 102

  Fly    57 YRSSLHCIQTIVSKEGPLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAM 121
            ||...|.:..|..:||.||||.||..||||||:|.|.::|:|..|..||.|:.: ...:..:|..
  Rat   103 YRGMFHALFRIYREEGILALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLE-DETLLINMIC 166

  Fly   122 GTIAGACGAFIGTPAEVALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGR 186
            |.::|...:.|..|.:|..:||.:.|.|      ...::..:...|.::||...||||.:||..|
  Rat   167 GVVSGVISSTIANPTDVLKIRMQAQGSL------FQGSMIGSFIDIYQQEGTRGLWRGVVPTAQR 225

  Fly   187 AMVVNMTQLASYSQFKTYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVD 251
            |.:|...:|..|...|.:.....: :.:.|..||.:|...||...:.|.|:|:.:||:.|.:.:.
  Rat   226 AAIVVGVELPVYDITKKHLIVSGM-LGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIV 289

  Fly   252 GKPE-YRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQ 302
            |..: |:||.|.:|::.:.||.|||:|||.|.:.||||..::.||..|||.:
  Rat   290 GHVDLYKGTLDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKR 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 39/103 (38%)
Mito_carr 118..207 CDD:278578 25/89 (28%)
Mito_carr 219..307 CDD:278578 35/86 (41%)
Slc25a14XP_006257593.1 Mito_carr 59..155 CDD:278578 39/96 (41%)
PTZ00169 63..342 CDD:240302 100/288 (35%)
Mito_carr 156..245 CDD:278578 25/96 (26%)
Mito_carr 253..342 CDD:278578 36/90 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D892773at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.