DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1907 and UCP3

Sequence 1:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_172866.1 Gene:UCP3 AraportID:AT1G14140 Length:305 Species:Arabidopsis thaliana

Alignment Length:300 Identity:106/300 (35%)
Similarity:158/300 (53%) Gaps:19/300 (6%)


  Fly     7 QEAPKKAVATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYR-SSLHCIQTIVSK 70
            :|||      ...:.|...||.|.|..|..|:||.|||||:.|:||....:| .:...:..|..|
plant     8 REAP------TGTRILLASLSAMVAESVTFPIDLTKTRMQLHGSGSASGAHRIGAFGVVSEIARK 66

  Fly    71 EGPLALYQGIGAALLRQATYTTGRLGMYTYLNDLF-REKFQRS---PGITDSMAMGTIAGACGAF 131
            ||.:.||:|:..|::|...||..|:..|..|..|. |.:...|   |..|.:: :|..:|.....
plant    67 EGVIGLYKGLSPAIIRHLFYTPIRIIGYENLKGLIVRSETNNSESLPLATKAL-VGGFSGVIAQV 130

  Fly   132 IGTPAEVALVRMTSDGRLPVAE--RRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQ 194
            :.:||::..|||.:|||| |::  :..|:....|..:|.:.||:..||:|.||.:.||.:|||.:
plant   131 VASPADLVKVRMQADGRL-VSQGLKPRYSGPIEAFTKILQSEGVKGLWKGVLPNIQRAFLVNMGE 194

  Fly   195 LASYSQFKTYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGT 259
            ||.|...| :|.......|:.|..|..||::|||.:|..|.|.|:.|||:.|.   .....||.:
plant   195 LACYDHAK-HFVIDKKIAEDNIFAHTLASIMSGLASTSLSCPADVVKTRMMNQ---GENAVYRNS 255

  Fly   260 ADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQ 299
            .|.|::..:.||:.||||||.|.:.||||...:.::..|:
plant   256 YDCLVKTVKFEGIRALWKGFFPTWARLGPWQFVFWVSYEK 295

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 34/95 (36%)
Mito_carr 118..207 CDD:278578 32/91 (35%)
Mito_carr 219..307 CDD:278578 32/81 (40%)
UCP3NP_172866.1 Mito_carr 9..104 CDD:278578 37/101 (37%)
PTZ00169 14..281 CDD:240302 98/273 (36%)
Mito_carr 110..209 CDD:278578 34/102 (33%)
Mito_carr 212..299 CDD:278578 34/87 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.