DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1907 and UCP2

Sequence 1:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_568894.1 Gene:UCP2 AraportID:AT5G58970 Length:305 Species:Arabidopsis thaliana

Alignment Length:295 Identity:87/296 (29%)
Similarity:139/296 (47%) Gaps:13/296 (4%)


  Fly    21 FLFGGLSGMGATMVVQPLDLVKTRMQI-----SGAGSGKKEYRSSLHCIQTIVSKEGPLALYQGI 80
            |:....:...|.:...|||..|.|:|:     :|.|....:||.|:..:.||..:||...|::|:
plant    16 FICSAFAACFAELCTIPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGISGLWKGV 80

  Fly    81 GAALLRQATYTTGRLGMYTYLNDLF-REKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMT 144
            .|.|.||..|...|:|:|..:..|. ...|.....:...:....:.||....:..|.::..||:.
plant    81 IAGLHRQCIYGGLRIGLYEPVKTLLVGSDFIGDIPLYQKILAALLTGAIAIIVANPTDLVKVRLQ 145

  Fly   145 SDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHGP 209
            |:|:||....|.|....:|...|.:.||::|||.|..|.:.|..:||..:||||.|.|......|
plant   146 SEGKLPAGVPRRYAGAVDAYFTIVKLEGVSALWTGLGPNIARNAIVNAAELASYDQIKETIMKIP 210

  Fly   210 LQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQEGVFA 274
            . ..:.:..|..|.:.:|........|:|:.|:|:.      |...||.|.|..::..:.||:.|
plant   211 F-FRDSVLTHLLAGLAAGFFAVCIGSPIDVVKSRMM------GDSTYRNTVDCFIKTMKTEGIMA 268

  Fly   275 LWKGFTPYYCRLGPHTVLTFIILEQLNQGYNKYVL 309
            .:|||.|.:.|||....:.|:.|||:.:.:.:.||
plant   269 FYKGFLPNFTRLGTWNAIMFLTLEQVKKVFLREVL 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 28/94 (30%)
Mito_carr 118..207 CDD:278578 29/89 (33%)
Mito_carr 219..307 CDD:278578 26/88 (30%)
UCP2NP_568894.1 Mito_carr 9..108 CDD:278578 28/92 (30%)
PTZ00169 11..296 CDD:240302 85/287 (30%)
Mito_carr 112..208 CDD:278578 29/96 (30%)
Mito_carr 212..300 CDD:278578 26/94 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.