DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1907 and DIC3

Sequence 1:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_196509.1 Gene:DIC3 AraportID:AT5G09470 Length:337 Species:Arabidopsis thaliana

Alignment Length:327 Identity:116/328 (35%)
Similarity:168/328 (51%) Gaps:51/328 (16%)


  Fly    21 FLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGK-----------------KEYR---------- 58
            ||.||::.:.|..:..||||:|.|||:.|..|..                 |.||          
plant     6 FLEGGIAAIIAGALTHPLDLIKVRMQLQGEHSFSLDQNPNPNLSLDHNLPVKPYRPVFALDSLIG 70

  Fly    59 -------------SSLHCIQT-------IVSKEGPLALYQGIGAALLRQATYTTGRLGMYTYLND 103
                         ||...:.|       ||..|||.||:.|:.|.:|||..|:..|:|:|.:|..
plant    71 SISLLPLHIHAPSSSTRSVMTPFAVGAHIVKTEGPAALFSGVSATILRQMLYSATRMGIYDFLKR 135

  Fly   104 LFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMTSDGRLPVAERRNYTNVANALARIT 168
            .:.::...:..:...:..|.||||.|:.:|.||:||:|||.:||.||:..||||.:|.:|:.||.
plant   136 RWTDQLTGNFPLVTKITAGLIAGAVGSVVGNPADVAMVRMQADGSLPLNRRRNYKSVVDAIDRIA 200

  Fly   169 REEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHGPLQMEEGIKLHFCASMLSGLLTTIT 233
            |:||:::|||||..||.|||:|..:|||:|...|.....|......||..|..||..:|::..:.
plant   201 RQEGVSSLWRGSWLTVNRAMIVTASQLATYDHVKEILVAGGRGTPGGIGTHVAASFAAGIVAAVA 265

  Fly   234 SMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILE 298
            |.|:|:.|||:.|.    .|..|.|..|..:::..:||..||:||..|...|.||.|::.|:.||
plant   266 SNPIDVVKTRMMNA----DKEIYGGPLDCAVKMVAEEGPMALYKGLVPTATRQGPFTMILFLTLE 326

  Fly   299 QL 300
            |:
plant   327 QV 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 38/135 (28%)
Mito_carr 118..207 CDD:278578 45/89 (51%)
Mito_carr 219..307 CDD:278578 30/83 (36%)
DIC3NP_196509.1 Mito_carr <19..139 CDD:278578 33/120 (28%)
Mito_carr 143..238 CDD:278578 45/95 (47%)
Mito_carr 251..336 CDD:278578 30/83 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I1222
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32190
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.