DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1907 and DIC2

Sequence 1:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_194188.1 Gene:DIC2 AraportID:AT4G24570 Length:313 Species:Arabidopsis thaliana

Alignment Length:311 Identity:117/312 (38%)
Similarity:171/312 (55%) Gaps:37/312 (12%)


  Fly    21 FLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKK--------------------EYRSSLHCIQ 65
            |:.||::.:.|.....||||:|.|:|:.|......                    |..||:..:.
plant     6 FVEGGIASVIAGCSTHPLDLIKVRLQLHGEAPSTTTVTLLRPALAFPNSSPAAFLETTSSVPKVG 70

  Fly    66 ------TIVSKEGPLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTI 124
                  .||..||..||:.|:.|.||||..|:|.|:|:|..|.:.:.:.......::..:..|.:
plant    71 PISLGINIVKSEGAAALFSGVSATLLRQTLYSTTRMGLYEVLKNKWTD
PESGKLNLSRKIGAGLV 135

  Fly   125 AGACGAFIGTPAEVALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMV 189
            ||..||.:|.||:||:|||.:|||||:|:||||..|.:|:..:.:.||:|:|||||..|:.|||:
plant   136 AGGIGAAVGNPADVAMVRMQADGRLPLAQRRNYAGVGDAIRSMVKGEGVTSLWRGSALTINRAMI 200

  Fly   190 VNMTQLASYSQFKTYFRHGPLQ---MEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVD 251
            |...|||||.|||    .|.|:   |.:|:..|..||..:|.:.::.|.|:|:.|||:.|||:  
plant   201 VTAAQLASYDQFK----EGILENG
VMNDGLGTHVVASFAAGFVASVASNPVDVIKTRVMNMKV-- 259

  Fly   252 GKPEYRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQ 302
              ..|.|..|..::..:.||..||:|||.|..||.||.||:.|:.|||:.:
plant   260 --GAYDGAWDCAVKTVKAEGAMALYKGFVPTVCRQGPFTVVLFVTLEQVRK 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 33/114 (29%)
Mito_carr 118..207 CDD:278578 46/89 (52%)
Mito_carr 219..307 CDD:278578 34/85 (40%)
DIC2NP_194188.1 Mito_carr 3..118 CDD:278578 33/112 (29%)
Mito_carr 122..220 CDD:278578 48/102 (47%)
Mito_carr 225..312 CDD:278578 35/89 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I1222
OMA 1 1.010
OrthoDB 1 1.010 D892773at2759
OrthoInspector 1 1.000 T32190
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
44.070

Return to query results.
Submit another query.