DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1907 and slc25a35

Sequence 1:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001092917.1 Gene:slc25a35 ZFINID:ZDB-GENE-060526-142 Length:298 Species:Danio rerio

Alignment Length:297 Identity:93/298 (31%)
Similarity:140/298 (47%) Gaps:13/298 (4%)


  Fly    21 FLFGGLSGMGATMVVQPLDLVKTRMQISG----AGSGKKEYRSSLHCIQTIVSKEGPLALYQGIG 81
            |:.||::..||.....||::||||||:.|    .|:.:..||:..|...||...:|...|.:|:.
Zfish     3 FILGGVAACGACFFTNPLEVVKTRMQLQGELKSRGTYQVYYRNVFHAFYTIGKIDGLAGLQKGLV 67

  Fly    82 AALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMTSD 146
            ..|:.|......|||.|.....|...........|.|...|.|||..||.:|:|..:....:.|.
Zfish    68 PGLVYQFFMNGVRLGSYALTESLGYIHTDGRVSATKSTVSGAIAGVVGAVMGSPIYLVKTHLQSQ 132

  Fly   147 GRLPVAERRNYTN--VANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHGP 209
            ....:|....|.:  :.|||..|.::.|:..||||:...:.|..|.:..|||::|..|.......
Zfish   133 STSSIAVGHQYKHRGMTNALFAIHKQHGILGLWRGASAAIPRVSVGSAAQLATFSASKEMVNDLQ 197

  Fly   210 LQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVD--GKPE-YRGTADVLLRVARQEG 271
            :..|....:...|.|:|.::..:...|.|:..||:.| :.||  ||.. |||..|...:..::||
Zfish   198 VFSEGSWLIALSAGMISSVVVVLAMTPFDVVSTRLYN-QPVDHLGKGMLYRGFVDCFSKTLKKEG 261

  Fly   272 VFALWKGFTPYYCRLGPHTVLTFII---LEQLNQGYN 305
            :..|:||....|.||||||:|:.:.   |..|:|.|:
Zfish   262 MTGLYKGLGASYFRLGPHTILSLLFWNELRCLHQSYS 298

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 30/92 (33%)
Mito_carr 118..207 CDD:278578 28/91 (31%)
Mito_carr 219..307 CDD:278578 33/94 (35%)
slc25a35NP_001092917.1 Solcar 1 1..90 29/87 (33%)
PTZ00169 2..291 CDD:240302 90/289 (31%)
Mito_carr 2..84 CDD:278578 28/81 (35%)
Mito_carr 97..195 CDD:278578 29/98 (30%)
Solcar 2 99..192 29/93 (31%)
Mito_carr 200..286 CDD:278578 30/87 (34%)
Solcar 3 202..293 30/92 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R857
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.