DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1907 and ucp2

Sequence 1:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_571251.1 Gene:ucp2 ZFINID:ZDB-GENE-990708-8 Length:310 Species:Danio rerio

Alignment Length:294 Identity:91/295 (31%)
Similarity:140/295 (47%) Gaps:15/295 (5%)


  Fly    16 TNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISG-------AGSGKKEYRSSLHCIQTIVSKEGP 73
            |..:||:..|.:...|.:...|||..|.|:||.|       .|.|..:||.....|.|:|..|||
Zfish    12 TATVKFIGAGTAACIADLFTFPLDTAKVRLQIQGENKASTNMGRGPVKYRGVFGTISTMVRVEGP 76

  Fly    74 LALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEV 138
            .:||.|:.|.|.||.::.:.|:|:|..:.. |..|.....||...:..|...||....:..|.:|
Zfish    77 RSLYSGLVAGLQRQMSFASVRIGLYDSVKQ-FYTKGSDHAGIGSRLMAGCTTGAMAVAVAQPTDV 140

  Fly   139 ALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKT 203
            ..||.  ..::.....:.|.:..:|...|.:|||...||:|:.|.:.|..:||.|:|.:|...|.
Zfish   141 VKVRF--QAQVSAGSSKRYHSTMDAYRTIAKEEGFRGLWKGTGPNITRNAIVNCTELVTYDLIKD 203

  Fly   204 YFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVAR 268
            ......| |.:.:..||.::..:|..|||.:.|:|:.|||..|    ..:.:|....:..:.:..
Zfish   204 ALLKSSL-MTDDLPCHFTSAFGAGFCTTIIASPVDVVKTRYMN----SAQGQYSSALNCAVAMLT 263

  Fly   269 QEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQ 302
            :||..|.:|||.|.:.|||...|:.|:..|||.:
Zfish   264 KEGPKAFYKGFMPSFLRLGSWNVVMFVTYEQLKR 297

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 35/100 (35%)
Mito_carr 118..207 CDD:278578 24/89 (27%)
Mito_carr 219..307 CDD:278578 28/85 (33%)
ucp2NP_571251.1 Mito_carr 10..112 CDD:278578 35/101 (35%)
Solcar 1 11..107 33/96 (34%)
PTZ00169 17..300 CDD:240302 89/290 (31%)
Mito_carr 113..209 CDD:278578 26/98 (27%)
Solcar 2 115..204 26/91 (29%)
Solcar 3 213..298 28/90 (31%)
Mito_carr 218..300 CDD:278578 28/85 (33%)
Purine nucleotide binding. {ECO:0000250} 277..299 8/22 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.