DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1907 and slc25a10

Sequence 1:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001017018.1 Gene:slc25a10 XenbaseID:XB-GENE-955175 Length:286 Species:Xenopus tropicalis

Alignment Length:289 Identity:103/290 (36%)
Similarity:148/290 (51%) Gaps:24/290 (8%)


  Fly    20 KFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQ-TIVSKEGPLALYQGIGAA 83
            ::.||||:..||.....||||:|..:|.      ::|.:..:..:. :::..:|.||||.|:.|:
 Frog     8 RWYFGGLASCGAACCTHPLDLIKVHLQT------QQEVKMRMTGMAISVIRNDGFLALYNGLSAS 66

  Fly    84 LLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMTSDGR 148
            |.||.||:..|..:|....|...:..:........:.:|.:.|..|.||||||::..|||.:|.:
 Frog    67 LFRQITYSLTRFAIYETARDRLMQDNKAPLPFYQKVLLGAVGGFTGGFIGTPADMVNVRMQNDVK 131

  Fly   149 LPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFK-----TYFRHG 208
            ||...||||.:..:.:.|:.||||...|:.|:.....|..:|.:.|||.|.|.|     |.|   
 Frog   132 LPAHLRRNYAHALDGMFRVIREEGFRKLFSGATMASSRGALVTVGQLACYDQAKQLVLNTGF--- 193

  Fly   209 PLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQEGVF 273
               :.:.|..||.||.::|...|....|||:.|||:.|     .|.||||.....|..|:. |..
 Frog   194 ---LSDNIFTHFLASSIAGGCATFLCQPLDVLKTRLMN-----AKGEYRGVVHCTLETAKL-GPL 249

  Fly   274 ALWKGFTPYYCRLGPHTVLTFIILEQLNQ 302
            |.:||..|...||.|||||||:.||||.:
 Frog   250 AFYKGLVPAGIRLIPHTVLTFVFLEQLRK 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 28/90 (31%)
Mito_carr 118..207 CDD:278578 36/94 (38%)
Mito_carr 219..307 CDD:278578 38/85 (45%)
slc25a10NP_001017018.1 PTZ00169 12..278 CDD:240302 102/284 (36%)
Mito_carr 12..92 CDD:278578 27/86 (31%)
Mito_carr 95..190 CDD:278578 34/95 (36%)
Mito_carr 197..281 CDD:278578 39/89 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.