DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1907 and rangrf

Sequence 1:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_002941865.2 Gene:rangrf XenbaseID:XB-GENE-5760490 Length:297 Species:Xenopus tropicalis

Alignment Length:146 Identity:31/147 (21%)
Similarity:57/147 (39%) Gaps:31/147 (21%)


  Fly   124 IAGACGAFIGT-----PAEVALVRMTSDGRLPV----AERRNYTNVANALARITREEGLTALWRG 179
            ||...|.|..|     .::|.:||.....|..|    ||.||.::..:.:|:.::...|.|   |
 Frog    60 IAVFAGKFFPTQPGRISSDVIIVRPEPALRAEVEGKHAEDRNASSADSPMAQDSQPHPLFA---G 121

  Fly   180 SLPTVGRAMVVNMTQLASYSQFKTYFRHGP---------LQMEEGI------KLHF----CASML 225
            :...|......::::|......:..|.|..         |:.:||:      :.||    .::..
 Frog   122 AFSAVLPPFSQDVSELREIPDNQEVFAHNATDQSIIVELLEYQEGVSDSDAARYHFEDVASSNDA 186

  Fly   226 SGLLTTITSMPLDIAK 241
            .|....::..||.:|:
 Frog   187 EGQSEVLSVEPLPLAQ 202

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578
Mito_carr 118..207 CDD:278578 21/92 (23%)
Mito_carr 219..307 CDD:278578 6/28 (21%)
rangrfXP_002941865.2 Mog1 117..297 CDD:238137 16/90 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C293130444
eggNOG 1 0.900 E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.710

Return to query results.
Submit another query.