DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1907 and slc25a11

Sequence 1:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001002099.1 Gene:slc25a11 ZFINID:ZDB-GENE-040625-79 Length:308 Species:Danio rerio

Alignment Length:317 Identity:187/318 (59%)
Similarity:225/318 (71%) Gaps:15/318 (5%)


  Fly     1 MSATSVQEAPKKAVATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQ 65
            |:|.:....||  .:..:||||||||:|||||:.||||||||.|||:||.||..:||::|.|.:.
Zfish     1 MAAAADTAKPK--TSPKSIKFLFGGLAGMGATVFVQPLDLVKNRMQLSGQGSKAREYKTSFHAVG 63

  Fly    66 TIVSKEGPLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGA 130
            :|:..||...:|.|:.|.|||||||||.|||:||.|.:...:.....|.......:|..|||.||
Zfish    64 SILRNEGVRGIYTGLSAGLLRQATYTTTRLGIYTILFERMSKADGTPPNFFMKALIGMTAGATGA 128

  Fly   131 FIGTPAEVALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQL 195
            |:||||||||:|||:|||||..:||.||||.|||.|||||||:|.||||.:||:.||:|||..||
Zfish   129 FVGTPAEVALIRMTADGRLPPDQRRGYTNVFNALVRITREEGVTTLWRGCIPTMARAVVVNAAQL 193

  Fly   196 ASYSQFKT------YFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKP 254
            |||||.|.      |||       :.|..||||||:|||:||..|||:||.|||||||:|:||||
Zfish   194 ASYSQSKQALLDSGYFR-------DDILCHFCASMISGLVTTAASMPVDIVKTRIQNMRMIDGKP 251

  Fly   255 EYRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQGYNKYVLGS 311
            ||....|||::|.|.||.|:|||||||||.|||||||||||.|||:|:.|..|.|.|
Zfish   252 EYNNGLDVLVKVIRNEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKFYKIYFLDS 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 53/93 (57%)
Mito_carr 118..207 CDD:278578 62/95 (65%)
Mito_carr 219..307 CDD:278578 63/88 (72%)
slc25a11NP_001002099.1 Mito_carr 18..96 CDD:278578 49/78 (63%)
PTZ00169 19..300 CDD:240302 177/288 (61%)
Mito_carr 110..207 CDD:278578 60/97 (62%)
Mito_carr 213..305 CDD:278578 65/92 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C293129730
eggNOG 1 0.900 E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H2637
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D404074at33208
OrthoFinder 1 1.000 FOG0004492
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127710
Panther 1 1.100 LDO PTHR45618
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.