DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1907 and slc25a34

Sequence 1:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_956874.1 Gene:slc25a34 ZFINID:ZDB-GENE-040426-1442 Length:319 Species:Danio rerio

Alignment Length:300 Identity:102/300 (34%)
Similarity:152/300 (51%) Gaps:29/300 (10%)


  Fly    19 IKFLFGGLSGMGATMVVQPLDLVKTRMQISG----AGSGKKEYRSSLHCIQTIVSKEGPLALYQG 79
            :.|..|.|:..||.:...||::||||:|:.|    .||.::.||..|..:..:...:|...|.:|
Zfish    26 LDFGLGALACCGACVFTNPLEVVKTRLQLQGELRARGSYRRLYRGVLQALWVVGRTDGLRGLQKG 90

  Fly    80 IGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITD----SMAMGTIAGACGAFIGTPAEVAL 140
            :.||||.|......|||.|..:         ::.|:||    |:..|..|||.||||.:||.:..
Zfish    91 LTAALLYQGLMNGLRLGSYAQM---------QAA
GVTDGPCCSLIAGAAAGALGAFIASPAYLVK 146

  Fly   141 VRMTSD--GRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKT 203
            ..:.:.  ..:.|..:.|:..:::||..|.|.||:..||||....|.|.||.:.||||::|..|.
Zfish   147 THLQAQTVAAIAVGHQHNHQGMSSALVSIYRREGVCGLWRGVNGAVPRVMVGSATQLATFSSAKD 211

  Fly   204 YFRH----GPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPE--YRGTADV 262
            :..|    .||.....:    ||:::||:..:|...|.|:..||:.|..:...|..  |.|..|.
Zfish   212 WITH
TQWFSPLSSLNTL----CAAVMSGVAVSIIMTPFDVISTRLYNQPVDQFKQGRLYCGFVDC 272

  Fly   263 LLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQ 302
            ||:|...|||..|:||.||.:.||.|||.|:.::.:.|.|
Zfish   273 LLKVCAAEGVLGLYKGMTPVFVRLAPHTTLSMLLWDVLRQ 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 30/94 (32%)
Mito_carr 118..207 CDD:278578 33/91 (36%)
Mito_carr 219..307 CDD:278578 33/86 (38%)
slc25a34NP_956874.1 Solcar 1 22..115 30/98 (31%)
Mito_carr 27..113 CDD:278578 30/95 (32%)
Solcar 2 119..212 34/93 (37%)
Mito_carr <141..215 CDD:278578 24/74 (32%)
Mito_carr 220..311 CDD:278578 34/95 (36%)
Solcar 3 222..313 34/95 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R857
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.