DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1907 and slc25a14

Sequence 1:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_017208245.1 Gene:slc25a14 ZFINID:ZDB-GENE-040426-749 Length:335 Species:Danio rerio

Alignment Length:283 Identity:99/284 (35%)
Similarity:151/284 (53%) Gaps:9/284 (3%)


  Fly    21 FLFGGLSGMGATMVVQPLDLVKTRMQISG-AGSGKKEYRSSLHCIQTIVSKEGPLALYQGIGAAL 84
            |::||::.:.|.....|:||.|||:|:.| ....:..||...|.:..|..:||..|||.||..||
Zfish    58 FVYGGMASIVAEFGTFPIDLTKTRLQVQGQTHCMEVRYRGMFHALLRIGREEGVRALYSGISPAL 122

  Fly    85 LRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMTSDGRL 149
            ||||:|.|.::|.|..|..||....:....:. ::..|.::|...:.:..|.:|..:||.:.|.|
Zfish   123 LRQASYGTIKIGTYNTLKKLFVSHPEEETMVI-NVFCGVVSGVLSSSLANPTDVLKIRMQAQGSL 186

  Fly   150 PVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHGPLQMEE 214
              .:....:|..|    |.:.||...||||.:||..||.:|...:|..|...|.:.....| |.:
Zfish   187 --LQGSMMSNFMN----IYQTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLIRSGL-MGD 244

  Fly   215 GIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQEGVFALWKGF 279
            .:..||.:|...||...:.|.|:|:.:||:.|.:::.|.|.|:||.|.|::..|.||.|||:|||
Zfish   245 TVLTHFISSFTCGLAGALASNPVDVVRTRMMNQRVLAGNPLYKGTLDGLMQTWRNEGFFALYKGF 309

  Fly   280 TPYYCRLGPHTVLTFIILEQLNQ 302
            .|.:.||||..::.|:..|||.:
Zfish   310 WPNWLRLGPWNIIFFMTFEQLKK 332

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 36/89 (40%)
Mito_carr 118..207 CDD:278578 25/89 (28%)
Mito_carr 219..307 CDD:278578 36/85 (42%)
slc25a14XP_017208245.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D892773at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R857
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.