DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1907 and CG18418

Sequence 1:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_647924.2 Gene:CG18418 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster

Alignment Length:304 Identity:173/305 (57%)
Similarity:222/305 (73%) Gaps:5/305 (2%)


  Fly    11 KKAVATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQTIVSKEGPLA 75
            ||.|.|: :||:.||.|||.||.:||||||:||||||||. .|.:||::|...:..::..||.|:
  Fly     9 KKTVPTH-MKFVMGGTSGMLATCIVQPLDLLKTRMQISGT-LGTREYKNSFEVLSKVLKNEGILS 71

  Fly    76 LYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVAL 140
            ||.|:.|.||||||||:.::|:|....|.:|:.|...|.:..||.||.:|||.||..|.||||||
  Fly    72 LYNGLSAGLLRQATYTSAKMGVYQMELDWYRKNFGNYPSMVASMTMGIVAGAFGAMCGNPAEVAL 136

  Fly   141 VRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYF 205
            :||.||.||...:||||.||.:|..||.::||:.|||||.||||||||||||.||||||..|...
  Fly   137 IRMMSDNRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMKNQL 201

  Fly   206 RHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQE 270
             ||  .:.|||.||..|:::|||||::||||||:||||||.||::||||||.||.|||.:|.:.|
  Fly   202 -HG--YLSEGIPLHLTAALVSGLLTSVTSMPLDMAKTRIQQMKVIDGKPEYSGTIDVLKKVLKNE 263

  Fly   271 GVFALWKGFTPYYCRLGPHTVLTFIILEQLNQGYNKYVLGSNKS 314
            |.||:|||||||..|:||||:.:|:.|||:|:.|:|::|..:.|
  Fly   264 GAFAVWKGFTPYLMRMGPHTIFSFVFLEQMNKAYSKHMLSDSLS 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 47/93 (51%)
Mito_carr 118..207 CDD:278578 57/89 (64%)
Mito_carr 219..307 CDD:278578 56/88 (64%)
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 50/100 (50%)
PTZ00169 18..296 CDD:240302 164/282 (58%)
Mito_carr 109..205 CDD:278578 60/99 (61%)
Mito_carr 208..300 CDD:278578 59/92 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C292795325
eggNOG 1 0.900 E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S777
OrthoDB 1 1.010 D404074at33208
OrthoFinder 1 1.000 FOG0004492
orthoMCL 1 0.900 OOG5_127710
Panther 1 1.100 P PTHR45618
RoundUp 00.000 Not matched by this tool.
76.790

Return to query results.
Submit another query.