DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1907 and Slc25a34

Sequence 1:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_006539059.1 Gene:Slc25a34 MGIID:2686215 Length:333 Species:Mus musculus

Alignment Length:329 Identity:94/330 (28%)
Similarity:156/330 (47%) Gaps:33/330 (10%)


  Fly     1 MSATSVQEAP---KKAVATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISG----AGSGKKEYR 58
            |..|..|.||   .:.:.:.|:..:.|..:...|.:...||::||||:|:.|    .|:..:.||
Mouse     1 MKPTQAQMAPAMDSREMVSPAVDLVLGASACCLACVFTNPLEVVKTRLQLQGELQAPGTYPRPYR 65

  Fly    59 SSLHCIQTIVSKEGPLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGT 123
            ..:..:..:...:|...|.:|:.|.||.|......|...|:.   ..:....:.||.|  :..|.
Mouse    66 GFVSSVAAVARADGLWGLQKGLAAGLLYQGLMNGVRFYCYSL---ACQAGLTQQPGGT--VVAGA 125

  Fly   124 IAGACGAFIGTPAEV---ALVRMTSD--------------GRLPVAERRNYTNVANALARITREE 171
            .|||.|||:|:||.:   :::.:.|.              ..:.|..:..:..|.:||..|.|::
Mouse   126 AAGALGAFVGSPAYLFPGSILELPSALNLQVKTQLQAQTVATMAVGHQHQHQGVLSALETIWRQQ 190

  Fly   172 GLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMP 236
            |:..||||....|.|..|.:..|||:::..|.:.:.....:|:...:.....|:|.:.......|
Mouse   191 GMLGLWRGVGGAVPRVTVGSAAQLATFTSAKAWVQDRQWFLEDSWLVTLAGGMISSIAVVAVMTP 255

  Fly   237 LDIAKTRIQNMKMVD--GKPE-YRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILE 298
            ||:..||:.| :.||  |:.: |.|.||.|::..:|||..||:||..|.|.||||||:|:....:
Mouse   256 LDVVSTRLYN-QPVDRAGRGQLYGGLADCLVKTCQQEGPLALYKGLGPAYLRLGPHTILSMFFWD 319

  Fly   299 QLNQ 302
            :|.:
Mouse   320 ELRK 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 23/97 (24%)
Mito_carr 118..207 CDD:278578 29/106 (27%)
Mito_carr 219..307 CDD:278578 33/88 (38%)
Slc25a34XP_006539059.1 Mito_carr 18..105 CDD:278578 22/87 (25%)
Mito_carr <156..227 CDD:278578 18/71 (25%)
Mito_carr 232..324 CDD:278578 34/94 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R857
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.