DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1907 and Ucp4B

Sequence 1:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_608977.1 Gene:Ucp4B FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster

Alignment Length:323 Identity:103/324 (32%)
Similarity:163/324 (50%) Gaps:30/324 (9%)


  Fly     7 QEAPK-KAVATN-----AIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSG----KKEYRSSL 61
            :|.|| :.:.||     ...:|....|...|.:|..|.|:.||||||.|..:.    |.:||..|
  Fly    20 KERPKLEYLVTNKKTPPVELYLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLL 84

  Fly    62 HCIQTIVSKEGPLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKF-----QRSPGIT--DSM 119
            .....||.:||.|.||.||.|.|.|.:.::  .:.|.||  |..|||.     ...|.::  .|.
  Fly    85 ATAMGIVREEGLLKLYGGISAMLFRHSLFS--GIKMLTY--DYMREKMIVPDEDGRPQLSFLGSC 145

  Fly   120 AMGTIAGACGAFIGTPAEVALVRMTSDGRLPV-AERRNYTNVANALARITREEGLTALWRGSLPT 183
            ..|.:|||..:.:..|.|:..::|..:|:..: .|.....||..||..|.|..|:..||:|::|.
  Fly   146 ISGVLAGATASVLTNPTELIKIQMQMEGQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTVPN 210

  Fly   184 VGRAMVVNMTQLASYSQFKTYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMK 248
            ..|:.:|.:..::.| .|...|......:.:..::.|.|:|.:|:...|.|:|.|:.|:||.|..
  Fly   211 TWRSALVTIGDVSCY-DFCKRFLIAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQP 274

  Fly   249 MVD-GKP-EYRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQL-----NQGY 304
            ..: |:. .|:|:.|.|.|:.|:||..|::|||.||:.|:||.:|:.::..||:     ::||
  Fly   275 TDEQGRGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRRFRGSEGY 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 38/102 (37%)
Mito_carr 118..207 CDD:278578 26/90 (29%)
Mito_carr 219..307 CDD:278578 35/94 (37%)
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 86/279 (31%)
Mito_carr 32..129 CDD:278578 36/101 (36%)
Mito_carr 138..233 CDD:278578 26/96 (27%)
Mito_carr 246..331 CDD:278578 33/85 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2010122
eggNOG 1 0.900 E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45618
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.